KEGG   Drosophila yakuba: Dyak_GE25711Help
Entry
Dyak_GE25711      CDS       T01068                                 

Definition
GE25711 gene product from transcript GE25711-RA
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dya00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dyak_GE25711
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dyak_GE25711
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE25711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 895 aa AA seqDB search
MAKLKKLHMSSNLEDLEKMSIIPDLRSKGMKILLNTARKLYMTAEEYRLDGDEELAYITY
MKYFNMLTAIHKKSDYASHKATVRQMLGDTESNRRIMDTLEVIINSLRHRYAQQRQEPEP
IAPDLVSNGRLSLDSPITPPIQYARLGLITCQDLYRRMQEKSVLVMDCRPSADYEASHLT
YYCAFNVPEELITAGMSAGRLQARLSSSGKASWASRSVKDSVVLMDWNTKDAQPAANTAI
STLLDILKNWDPDVTYRAPIQIVEGGYEYFIMMYPTHSTNPSVQAPQQNNNDIETIDDIE
YPSIHDITMKEDISAKDFRPRPDINRANKPAANRTYDQGISRSSPPAKPIAEIMRDQAEF
LQRAEQNDEQLERASKMWKRQAAEGDGLTATEDQELHFRILQLESKAQDYIVENNRLREE
LTRIQELHNVTQQLSQKEVEATRNIESKIRERQRLDEQHELERQERERLLAIARETKKHY
KSPTPSGPPSPGRNLEDLQVVSDSLESLLQLTGEDPTLAPNKVERPTFDRAMKPHPRNVE
RTSQRVRDFSPVIGQNVGRGLTGLKNLGNTCYMNSILQCLSNTPQLTEYCISDKYKNYIS
RSNKTNGQVIEEVAALIKELWNGQYKCVASRDLRYVVGQYQKIFRGVDQQDSHEFLTILM
DWLHSDLQTLHVPRQREMISASEKAWLEFTKAKESMILHLFYGQMKSTVKCVVCHKESAT
YESFSNLSLELPPNSNVCQLNQCMDMYFSGERIHGWNCPNCKTKRDAIKKLDISKLPPVM
VVHLKRFYADPSNSGAYMKKQNYLRFPLENLDMNPYIARAESRAVTPKTYQLYAVSNHYG
TMEGGHYTAFCKSANYGKWFKFDDQVVSALDSSNVVSSAAYILFYTWLPPMQVSL
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggccaagttgaagaagctgcacatgagctccaacctggaggacctggagaagatgtct
atcattccggatctgcgcagcaagggcatgaaaatcctgctgaacaccgcccgcaaactg
tacatgaccgccgaggagtacagactggatggcgacgaggagctggcctacatcacctac
atgaagtactttaatatgctgaccgctattcacaaaaaatccgattacgccagccacaag
gcgacggtgcgccagatgctgggcgacaccgagtcgaatcgccgcattatggacacgctg
gaggtgattatcaactccctgcggcatcgatatgctcagcagcgccaggagccagaacca
attgctcccgacctggttagcaatgggcgtctaagtctggactcgccgataacaccgcca
atacagtacgcccgacttggactgatcacctgtcaggatctgtatcggcgaatgcaagaa
aaatcggttctagttatggactgtcgcccaagcgccgactacgaggcctcccacctcact
tactactgtgcatttaatgtgcctgaggagttaataacggcaggaatgtcggctggcaga
ttgcaggctcgtctcagcagcagtggtaaggcatcgtgggcatcgcgttccgtcaaggat
tcggtggttcttatggactggaataccaaggatgcccaaccggcggccaacacagccatt
tcaacccttcttgacattctaaagaactgggatccggatgtgacttaccgcgctcccatt
cagattgtcgagggcggttacgagtacttcattatgatgtacccaactcattccactaat
cccagtgtacaggcgccgcagcagaacaacaatgatattgaaaccatcgatgacattgag
tatccctcaattcacgacatcaccatgaaggaggatattagtgcgaaggacttcagacca
agaccagacataaatcgggcaaacaagcccgcggccaatcgcacttatgaccagggaatt
tcccgttcttctccgccggctaaacctatcgctgagatcatgcgtgatcaggctgagttt
ttacagcgggcggagcaaaacgatgagcagttggagagggcctcaaaaatgtggaagcgt
caagcagcagagggcgatggattgactgctaccgaggaccaggagctgcacttcaggatc
ctacagttggagagcaaggctcaagactatatagttgaaaacaatcgactgcgagaagaa
ctaactcgcatacaagagctacacaatgttacacagcagttgtcgcaaaaggaggtcgag
gcaacgaggaatatagagtccaagatacgcgaacgacaacgcttggacgagcagcatgaa
cttgaacgtcaggagcgggagcgacttttggcgatcgctcgcgagacaaaaaaacattac
aaatcaccaacaccttcgggtccgccatcgccgggcaggaacttggaggatttacaggtc
gtgtcagacagcctagaatccctgctgcagttaaccggcgaggatccgacacttgcgcca
aacaaggtggaaaggcctacattcgatagggcgatgaaaccgcacccgaggaacgtggag
aggacatcgcaacgcgttcgtgatttctcgcccgtcattggtcagaatgtgggtcgtggc
ctgactggtttgaagaatctgggcaatacctgctatatgaacagcatactccagtgcctg
agcaacacgcctcagttgacggagtactgcatctcggacaaatacaagaattacatcagc
agaagcaataagaccaatgggcaagtgatcgaggaggtggctgcactcatcaaagagctt
tggaatggacagtacaagtgtgtggctagccgagacttgagatatgttgtgggccagtac
cagaagatctttcgcggcgttgaccagcaggattcacacgaattcctcaccatcctgatg
gactggctgcactcggatctccaaaccctacatgtgccccgtcagcgtgagatgatcagt
gcgtcggagaaggcttggctggaatttaccaaggcaaaggagagcatgattctgcattta
ttctacggccaaatgaagagcactgtcaagtgtgtggtctgtcataaggagtcggccacg
tacgagagcttttctaatctcagtttggagctgccgcccaactcgaatgtctgccagctg
aaccagtgcatggacatgtactttagtggagaacggatccatggctggaattgtcctaat
tgtaaaaccaaaagagatgccattaagaagctggatatatctaaactgccacctgtgatg
gtggttcatctgaagcggttctatgcggaccccagtaattccggcgcctacatgaaaaag
caaaattacctgcgcttcccgctggagaacctggacatgaatccctacatagcacgggcg
gaatcgcgggcggttacgcccaagacctaccagttgtacgccgtgtccaaccactacggc
actatggaaggcggccactatacggccttttgcaagagcgccaactacggaaagtggttc
aagttcgacgatcaggtcgtctcagcgctggactcctcgaacgttgtttccagcgctgcc
tacattctcttctacacctggctgcctcctatgcaggtgtcactgtag

DBGET integrated database retrieval system