KEGG   Drosophila yakuba: Dyak_GE25849Help
Entry
Dyak_GE25849      CDS       T01068                                 

Definition
GE25849 gene product from transcript GE25849-RA
Orthology
K04459  
dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 479 aa AA seqDB search
MCVNRETQSSSNNNHNNNTTATSTARNNNSHNGRCECDGDGNSVSHIQSEMKMRIKREAP
CLLLFMPIQNTNNNNRIGANQKDYPNKRSRENLACDEVTSTTSSSTAMNGSGRTPALTRS
CSSPAVYDIETHPASPVFPHLLLGNGRDADDPSSVGANCVLNVTCQNPNESHLQGLKYMQ
IPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLL
EAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSPSNPSGSAVGLSTQS
SQLVEQPEEEEIEEKREQRERGKSKSDSEAMDEDGFDYDDVDSGAGSLAGSNCSSRLTSP
PITPDDEAPSTSAAASTVSELDSPSSTSSSSGICSLLQSTSSSVSPCAISKPNLLSPTRQ
LALFKRNSPAKLRLDLESSYAPASPIPNTMPWISVPSTPVCDEAPESRINHLASNLTRD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtgaatcgagaaacgcagagcagcagcaacaataatcacaacaacaacacaacg
gcaacgtcaacagcacgcaacaacaacagccacaacgggcgctgtgagtgcgacggagac
ggcaacagcgtgagtcatatacaaagtgaaatgaaaatgcggataaagcgagaagcgccg
tgtcttctgttatttatgccaatccaaaataccaacaacaacaatcgcattggtgccaat
cagaaggactatcccaacaagcggtccagggagaatctggcatgtgacgaagtgacatcg
acgacgtcatcatccacggcaatgaacggcagcggacggacgccggcgctaacccgcagc
tgctccagtccagcggtctacgatattgaaacacaccccgcctcgcccgtttttccgcat
ctattgctgggcaatggccgcgatgccgacgatcccagcagcgtgggcgccaactgtgtg
ctgaacgttacctgccaaaatcccaatgagagccatctgcagggcctcaagtacatgcaa
atacctgccagcgatacgccgcatcagaacatcaagcagtacttccaggaggcgtacgac
tttatcgaagatgcacggaaaacgggttcccgtgtgctgttgcattgccacgcggggatt
tcgcggagcgccaccatcgccatcgcctacgtcatgcggtacaagtcgctctccctgctg
gaggcctacaagctggtgaaagtggcccggccgatcatctcgcccaatctgaacttcatg
ggccagctgctggagctggagcagaatttgcgcaagagcggagtcctggcgcccgctacc
ccgcacctgaatagtcctagcaatccatcgggatctgctgtgggattaagcacccaatct
agtcaactggtggagcagccggaggaggaggagatagaggagaagagggagcagcgggaa
cggggaaaatccaagtcggatagcgaggccatggacgaggatgggttcgactacgatgat
gtagacagcggcgcgggcagcctggcgggcagtaactgctcctcccggttaacctcgcct
ccgattaccccggatgatgaggcgcccagcacttcggcggcagcgtcgacggtttcggaa
cttgattcacccagctccacaagcagcagcagtggcatctgctctctgctgcagtccacc
agctcatccgtatcaccctgcgcaatcagcaagccaaatctgctgtcgcccacaaggcag
ttggctctgttcaagcggaattcgcccgccaagctgcgattggatctggagtccagctat
gcgcctgcgtcacccatcccaaacaccatgccctggatttcggtgccatccacgcccgtc
tgcgatgaggcaccggaaagcaggattaaccatttggccagcaacttgacgagggactga

DBGET integrated database retrieval system