KEGG   Drosophila yakuba: Dyak_GE25849Help
Entry
Dyak_GE25849      CDS       T01068                                 

Gene name
dyak_GLEANR_9444
Definition
(RefSeq) GE25849 gene product from transcript GE25849-RA (EC:3.1.3.- 3.1.3.48)
  KO
K20216  
dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
dya  Drosophila yakuba
Pathway
Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dyak_GE25849 (dyak_GLEANR_9444)
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dyak_GE25849 (dyak_GLEANR_9444)
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Dyak_GE25849 (dyak_GLEANR_9444)
    3.1.3.48  protein-tyrosine-phosphatase
     Dyak_GE25849 (dyak_GLEANR_9444)
Protein phosphatases and associated proteins [BR:dya01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    Dyak_GE25849 (dyak_GLEANR_9444)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 479 aa AA seqDB search
MCVNRETQSSSNNNHNNNTTATSTARNNNSHNGRCECDGDGNSVSHIQSEMKMRIKREAP
CLLLFMPIQNTNNNNRIGANQKDYPNKRSRENLACDEVTSTTSSSTAMNGSGRTPALTRS
CSSPAVYDIETHPASPVFPHLLLGNGRDADDPSSVGANCVLNVTCQNPNESHLQGLKYMQ
IPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLL
EAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSPSNPSGSAVGLSTQS
SQLVEQPEEEEIEEKREQRERGKSKSDSEAMDEDGFDYDDVDSGAGSLAGSNCSSRLTSP
PITPDDEAPSTSAAASTVSELDSPSSTSSSSGICSLLQSTSSSVSPCAISKPNLLSPTRQ
LALFKRNSPAKLRLDLESSYAPASPIPNTMPWISVPSTPVCDEAPESRINHLASNLTRD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtgaatcgagaaacgcagagcagcagcaacaataatcacaacaacaacacaacg
gcaacgtcaacagcacgcaacaacaacagccacaacgggcgctgtgagtgcgacggagac
ggcaacagcgtgagtcatatacaaagtgaaatgaaaatgcggataaagcgagaagcgccg
tgtcttctgttatttatgccaatccaaaataccaacaacaacaatcgcattggtgccaat
cagaaggactatcccaacaagcggtccagggagaatctggcatgtgacgaagtgacatcg
acgacgtcatcatccacggcaatgaacggcagcggacggacgccggcgctaacccgcagc
tgctccagtccagcggtctacgatattgaaacacaccccgcctcgcccgtttttccgcat
ctattgctgggcaatggccgcgatgccgacgatcccagcagcgtgggcgccaactgtgtg
ctgaacgttacctgccaaaatcccaatgagagccatctgcagggcctcaagtacatgcaa
atacctgccagcgatacgccgcatcagaacatcaagcagtacttccaggaggcgtacgac
tttatcgaagatgcacggaaaacgggttcccgtgtgctgttgcattgccacgcggggatt
tcgcggagcgccaccatcgccatcgcctacgtcatgcggtacaagtcgctctccctgctg
gaggcctacaagctggtgaaagtggcccggccgatcatctcgcccaatctgaacttcatg
ggccagctgctggagctggagcagaatttgcgcaagagcggagtcctggcgcccgctacc
ccgcacctgaatagtcctagcaatccatcgggatctgctgtgggattaagcacccaatct
agtcaactggtggagcagccggaggaggaggagatagaggagaagagggagcagcgggaa
cggggaaaatccaagtcggatagcgaggccatggacgaggatgggttcgactacgatgat
gtagacagcggcgcgggcagcctggcgggcagtaactgctcctcccggttaacctcgcct
ccgattaccccggatgatgaggcgcccagcacttcggcggcagcgtcgacggtttcggaa
cttgattcacccagctccacaagcagcagcagtggcatctgctctctgctgcagtccacc
agctcatccgtatcaccctgcgcaatcagcaagccaaatctgctgtcgcccacaaggcag
ttggctctgttcaagcggaattcgcccgccaagctgcgattggatctggagtccagctat
gcgcctgcgtcacccatcccaaacaccatgccctggatttcggtgccatccacgcccgtc
tgcgatgaggcaccggaaagcaggattaaccatttggccagcaacttgacgagggactga

DBGET integrated database retrieval system