KEGG   Drosophila yakuba: Dyak_GE25993Help
Entry
Dyak_GE25993      CDS       T01068                                 

Definition
GE25993 gene product from transcript GE25993-RA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dyak_GE25993
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Dyak_GE25993
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Dyak_GE25993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 605 aa AA seqDB search
MPAGKCGCLKKEARVHVIYVGGTIGMIRNESGVLHAVPMVLGQQLQEFPSCHDRHYKNKV
DDCGMMVLPAVSGAPYRVLYDLIEFSPLVDSSCMGFCDWKRIANEVGRSYNSYDGFVILH
GTDTLAYSASALAFMLESLNKPVVFTGAQIPIFEARSDGRENFLGALLIAGNYSIPEVLV
FFGNKILRGCRSTKLSTDSFHALDSPNLAPLGRANVNIEINSRQIFRPCNIKPFSLQSEL
EKNVALLRIYPGISVSVVQAILKDPTKGVVLQTYGAGNFPVNREDLLDELREAVHRGVII
VNITQCSAGMVANIYETGQGLLDVGVIPGYDMTQEAAFTKLAYVLSKPEWDIANKKKVML
LSLRGELTTNKVAKINDIDLIEGVARTLHMSTAMERQQMCSTFYPALVAAAVTEGDVHKL
GDLKQYGANLCDTNCDGRSAMHLACFLGKLNCVCFLISAGCPVNVHDRFNRTPLHEAIDT
DNHDIIKTLLKNDAKLNDPPLVQAELLRALTERAKIKRLESFRLAGANLTLADRTGRTAL
HYACQLGNHEVVEYLLPHYENPYIKDELGMSPIDYAKAANHAHILTLMRFKEKELAKQDP
CSCTN
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgccagcggggaagtgcggttgcttgaagaaggaggctcgcgtccatgtcatctacgtt
ggtggaaccatcggaatgatccgcaacgagtccggagtactgcacgccgtacccatggtg
ctgggtcagcagcttcaggagtttcccagctgccacgacaggcattacaaaaacaaggtg
gatgactgtgggatgatggtgttacccgctgtgtctggtgctccgtatagagtcctttac
gatttgattgagttcagcccactggtggactccagctgcatgggcttctgcgactggaag
cgcattgccaacgaagtgggaagatcatacaattcctacgacggcttcgtgatcctccat
ggaactgataccctagcttactccgcctcggcactagctttcatgctggagagcctgaac
aaacccgtggtatttactggggcacagattccgatctttgaggctcgcagcgatggtcgt
gagaacttcttgggcgcacttctgatagcaggcaattacagtatacccgaggtgctggtc
ttctttggcaacaagattctgcgtggctgtcgctccacgaagctcagtacggactccttc
catgctctggactcacccaatttggcaccattgggtcgggcgaatgtcaacatcgagata
aacagccgccaaatcttccggccatgcaatataaagccgttttcgcttcaatcggaactg
gaaaagaacgtggccctgctgcggatctatccgggaataagtgtcagtgtggtgcaggca
atactgaaggatccaacgaaaggtgtggttctccagacctatggagccggcaactttccg
gtgaatcgtgaggacttgctggacgaactcagggaggctgtacacagaggcgtcattatc
gtcaacatcacgcagtgctcggcgggcatggtggctaacatttacgagacgggtcagggg
ctgctcgacgtgggcgtgattcccggctacgatatgactcaggaggccgcctttaccaag
ctggcctatgtgctgtccaagccggagtgggacattgccaacaagaagaaggtgatgctg
ctgagtctgcgcggcgagctgaccaccaataaggtggccaagatcaacgatattgacctg
atcgagggcgtggcccgcacattgcacatgtccacggcgatggaacggcagcagatgtgc
tccacgttctatcccgctttggtggcggccgcagtcaccgaaggtgatgtccacaagttg
ggcgatctcaagcagtacggcgccaatctgtgcgacacaaactgcgatgggcgctccgcc
atgcacttggcctgcttcctgggcaaactaaattgcgtctgcttcctgatctccgccggt
tgtccggtaaatgtccacgatcgattcaaccgcactccattgcacgaggccatcgacacg
gacaaccatgacataattaagacgctcctcaaaaacgatgccaagctcaacgatccgccg
ctggtccaggcggagctactgcgtgcccttaccgagcgggctaagatcaagcgattggag
tcattccggctggccggtgccaatctcacgctggccgatcggacaggtcgaaccgcgctg
cactacgcctgccagttgggcaaccacgaggtggtcgaatatctgctgccgcactacgag
aatccctacatcaaggatgagctgggcatgtcgcccatcgactacgccaaggcagccaat
catgcccacatcctgacgctgatgcgattcaaggagaaggagctggccaagcaagatccg
tgttcctgtacgaattag

DBGET integrated database retrieval system