KEGG   Drosophila yakuba: Dyak_GE26074Help
Entry
Dyak_GE26074      CDS       T01068                                 

Definition
GE26074 gene product from transcript GE26074-RA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dya  Drosophila yakuba
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dyak_GE26074
   00053 Ascorbate and aldarate metabolism
    Dyak_GE26074
   00500 Starch and sucrose metabolism
    Dyak_GE26074
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dyak_GE26074
   00860 Porphyrin and chlorophyll metabolism
    Dyak_GE26074
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dyak_GE26074
   00982 Drug metabolism - cytochrome P450
    Dyak_GE26074
   00983 Drug metabolism - other enzymes
    Dyak_GE26074
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dyak_GE26074
Glycosyltransferases [BR:dya01003]
 Others
  Hydrophobic molecule
   Dyak_GE26074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 526 aa AA seqDB search
MLGGPGIAGLLLTILLLGLLCPKLANAENILAVFSYTFGSSYLLITPYLRNLVQRGHHVT
LISAVTIMPTIEGVHHIRVPKLDMLMEALLEYDYDVHNTKWTEAQFVSEYFYNCSKFVLE
DPGVQQLLHNASAQYSLIILEAAHNDALFGFSQHFNAPLVGIAAYGSSWNIDFLVGNSAP
SVYEPMSALGYSPGHSLMEKWHNLIFITEERLVERFIYLPGQIDLYKKHFPGLTASIHDL
RRRFSLILINQHFSMGRVRSNVPNIVEVAGMHLDEAPHTLDAELKKILDEAEQGVIYFSM
GLQVVDNWLPPDMRATMSEVFAQLKLQVIWKSDHPAMVNQSSNVISRTWFPQREILNHPN
VKLFITHAGLLSLIEAVHYAVPVLCIPLFYDQFQNTKRMEKLGVARTVDYTNLSRDEIVL
VIEDLVYNASYKQNVRDLSQRFHDQPMSAMKTAIWWTEYILRHKGADHMRIAEQEMSLMQ
YYNVDVVSVLFGRIGLSAIIVIFLGWKLVSLATRNLEYRLNVPIVR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcggcccgggtattgctggtctactgctcaccattctgcttttgggccttctg
tgtccaaagctggccaatgcggaaaatattttggctgttttctcatacacctttggctcg
tcctacttgctgattactccgtaccttaggaatcttgtccaacggggtcaccatgtcact
ctgatatcggccgttacgataatgcccaccatagagggtgtccatcacattcgagtgccc
aaattggatatgctaatggaagcgctcctggaatacgattacgacgttcataatactaag
tggacggaggctcagttcgtgtccgaatacttttacaattgttcaaagttcgtcctcgag
gatcctggcgtgcagcagctgctccacaacgccagtgcgcagtattcgttgattattttg
gaggcggcccacaacgatgccctcttcggattttcgcagcacttcaatgcaccgctggtg
gggattgccgcttacggatcgtcgtggaacatagactttctggtggggaactcggcgcca
agtgtctacgaaccgatgtccgccttgggctactcacctggccacagtctgatggagaag
tggcacaacctgatcttcataaccgaggagcgcctggtggagcgattcatctacctgccg
ggccaaatagatctgtacaagaaacacttccccgggttgaccgccagtatccatgaccta
cgccgcagattctcactgatcctgatcaatcagcatttcagcatgggccgcgtgcgcagt
aatgtgcccaatatcgtagaagtggcgggtatgcatctggacgaagcaccacataccttg
gatgctgaacttaaaaaaattttggatgaagccgaacagggagttatctacttttcaatg
ggcctgcaagtagtggataactggttgcccccagatatgcgagctactatgtcggaggtc
tttgcgcagttgaaactacaagtgatttggaagagtgaccatccagcgatggtcaaccaa
tcaagtaatgttatttctagaacatggtttcctcaacgggagatacttaatcatcctaat
gtaaagctatttattacccatgctggtctgttgagccttatcgaggcagttcactatgcg
gttcccgtgctttgtatacctttgttttacgatcagtttcaaaacaccaagcgaatggag
aaattgggcgtggccaggactgtggattatacaaacctttcccgggacgaaattgtcctg
gtcattgaggatctcgtgtacaatgctagttataaacaaaatgtcagggatttatcgcaa
cgatttcatgaccaacccatgtcggccatgaaaaccgcgatttggtggactgaatacatc
ctgcggcacaagggtgccgatcacatgagaatcgccgagcaggaaatgtccttgatgcaa
tactataacgttgatgtggtttctgttctattcggcagaatcggactaagtgctattatt
gttatctttctcggctggaaactagtctcattggcaacaagaaaccttgagtaccgattg
aatgtgcctatcgtaagataa

DBGET integrated database retrieval system