KEGG   Drosophila yakuba: Dyak_GE26107Help
Entry
Dyak_GE26107      CDS       T01068                                 

Gene name
dyak_GLEANR_968
Definition
(RefSeq) GE26107 gene product from transcript GE26107-RA (EC:3.4.19.12)
  KO
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dyak_GE26107 (dyak_GLEANR_968)
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE26107 (dyak_GLEANR_968)
Ubiquitin system [BR:dya04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dyak_GE26107 (dyak_GLEANR_968)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 475 aa AA seqDB search
MPAFKVKVKWGRELYTDIDVNTDEEPILFKAQLFALTGVQPDRQKVMCKGGILKDDQWNL
QIKDGAVVLLLGSKESVPEVPATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQ
CLNAVPELRTALSTFSHDGTDTMSTAFSISSAMKSIFAQMEKGTTVTPIVLLQALHRASP
QFAQTGENGTYRQQDANECWAEILKMLQQKLRPTNQEPSNTVQKRHSSFIDQFFGGTFEV
KMSSEEDPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLMKKSETLGRDAKYIR
TYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPMDFDAFELCTPELQNKLCPMRSK
FKDLEDKKMEVDVVKRNEPNEEKKDVKYEQFWFDDDLGSNNSGYYTLQAVLTHKGRSSSS
GHYVAWVRSSGDVWFKFDDDEVSAVATDEILRLSGGGDWHCAYVLLYAPRRLEKL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcatttaaagttaaggtgaagtggggccgggagctctacacagatatcgatgta
aacaccgacgaagagccaatattgtttaaggcccagttgtttgccctcactggcgttcaa
ccggatcgccagaaagttatgtgcaagggcggcattctcaaggatgatcagtggaatctg
cagatcaaggacggcgctgtggtcttgttgctgggcagcaaggaaagtgtaccagaagtg
cccgccactccggtcaaattcattgaggacatgaatgaagctgaagccgccacagcgatg
cgtctaccagctggtctgacaaatcttggcaatacgtgctacatgaacgccactgttcag
tgcctaaatgcagtgcccgagctgcgcactgccctcagcactttcagtcatgatggaacc
gacaccatgtcgaccgcattttccatatcgtctgccatgaagtctatatttgctcaaatg
gagaagggcacaaccgtgacgccaattgtgctgctgcaggcattgcaccgggcatcaccg
caattcgcccagactggcgagaatggcacgtacaggcagcaggacgccaatgagtgctgg
gcggaaatcctgaaaatgttgcagcaaaaactgcggccaacaaaccaggaaccatcgaat
actgtccagaaaaggcacagctcgtttatcgaccagttttttggcggcacttttgaagtt
aagatgagctcagaagaggatcccgatgaaccttcaacagtaacaagcgaaaatttcttg
cagttaagttgcttcatttcaatggatgtgaagtacatgcagagcggcctaaaatctaaa
atgaaagagcagctgatgaaaaaatctgaaaccctaggacgtgatgcaaagtacattcgt
acttacttggtgagccgacttccagcctatcttaccgtacaattcgttcgctttcaatac
aaaggaaaggagggcataaatgccaaggtgttgaaggatataaaattccccatggacttt
gatgcctttgagctgtgtactcccgaattgcaaaacaagctctgtccaatgcgctcgaaa
ttcaaggatctggaagacaagaaaatggaagttgatgttgtcaaacgcaatgaacccaac
gaagagaaaaaggacgtcaagtacgagcagttttggttcgatgacgacttgggcagcaac
aattcgggatactatacgctgcaggcggtgctcacgcacaagggtcgctcgagttcatcg
ggccattatgtggcctgggttcgctccagcggagatgtatggttcaagttcgatgatgat
gaggtctctgcagtggccacggacgagatcttgcggctttccggcggtggagattggcac
tgcgcctacgtcctgttatatgcgcccagacgtttggagaaactataa

DBGET integrated database retrieval system