KEGG   Drosophila yakuba: Dyak_GE26107Help
Entry
Dyak_GE26107      CDS       T01068                                 

Definition
GE26107 gene product from transcript GE26107-RA
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dyak_GE26107
Peptidases [BR:dya01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dyak_GE26107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 475 aa AA seqDB search
MPAFKVKVKWGRELYTDIDVNTDEEPILFKAQLFALTGVQPDRQKVMCKGGILKDDQWNL
QIKDGAVVLLLGSKESVPEVPATPVKFIEDMNEAEAATAMRLPAGLTNLGNTCYMNATVQ
CLNAVPELRTALSTFSHDGTDTMSTAFSISSAMKSIFAQMEKGTTVTPIVLLQALHRASP
QFAQTGENGTYRQQDANECWAEILKMLQQKLRPTNQEPSNTVQKRHSSFIDQFFGGTFEV
KMSSEEDPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLMKKSETLGRDAKYIR
TYLVSRLPAYLTVQFVRFQYKGKEGINAKVLKDIKFPMDFDAFELCTPELQNKLCPMRSK
FKDLEDKKMEVDVVKRNEPNEEKKDVKYEQFWFDDDLGSNNSGYYTLQAVLTHKGRSSSS
GHYVAWVRSSGDVWFKFDDDEVSAVATDEILRLSGGGDWHCAYVLLYAPRRLEKL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcatttaaagttaaggtgaagtggggccgggagctctacacagatatcgatgta
aacaccgacgaagagccaatattgtttaaggcccagttgtttgccctcactggcgttcaa
ccggatcgccagaaagttatgtgcaagggcggcattctcaaggatgatcagtggaatctg
cagatcaaggacggcgctgtggtcttgttgctgggcagcaaggaaagtgtaccagaagtg
cccgccactccggtcaaattcattgaggacatgaatgaagctgaagccgccacagcgatg
cgtctaccagctggtctgacaaatcttggcaatacgtgctacatgaacgccactgttcag
tgcctaaatgcagtgcccgagctgcgcactgccctcagcactttcagtcatgatggaacc
gacaccatgtcgaccgcattttccatatcgtctgccatgaagtctatatttgctcaaatg
gagaagggcacaaccgtgacgccaattgtgctgctgcaggcattgcaccgggcatcaccg
caattcgcccagactggcgagaatggcacgtacaggcagcaggacgccaatgagtgctgg
gcggaaatcctgaaaatgttgcagcaaaaactgcggccaacaaaccaggaaccatcgaat
actgtccagaaaaggcacagctcgtttatcgaccagttttttggcggcacttttgaagtt
aagatgagctcagaagaggatcccgatgaaccttcaacagtaacaagcgaaaatttcttg
cagttaagttgcttcatttcaatggatgtgaagtacatgcagagcggcctaaaatctaaa
atgaaagagcagctgatgaaaaaatctgaaaccctaggacgtgatgcaaagtacattcgt
acttacttggtgagccgacttccagcctatcttaccgtacaattcgttcgctttcaatac
aaaggaaaggagggcataaatgccaaggtgttgaaggatataaaattccccatggacttt
gatgcctttgagctgtgtactcccgaattgcaaaacaagctctgtccaatgcgctcgaaa
ttcaaggatctggaagacaagaaaatggaagttgatgttgtcaaacgcaatgaacccaac
gaagagaaaaaggacgtcaagtacgagcagttttggttcgatgacgacttgggcagcaac
aattcgggatactatacgctgcaggcggtgctcacgcacaagggtcgctcgagttcatcg
ggccattatgtggcctgggttcgctccagcggagatgtatggttcaagttcgatgatgat
gaggtctctgcagtggccacggacgagatcttgcggctttccggcggtggagattggcac
tgcgcctacgtcctgttatatgcgcccagacgtttggagaaactataa

DBGET integrated database retrieval system