KEGG   Drosophila yakuba: Dyak_GE26150Help
Entry
Dyak_GE26150      CDS       T01068                                 

Definition
GE26150 gene product from transcript GE26150-RA
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
dya  Drosophila yakuba
Brite
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dyak_GE26150
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   Dyak_GE26150
Protein phosphatases and associated proteins [BR:dya01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dyak_GE26150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 417 aa AA seqDB search
MSHPSDHVLRPKENAPVRMPEKSTAVLNTQKNLLLGKKPNSENVAPTSKPLPGSTGAVIR
SAATTVRPATTVRPATTVRPATKPGLGGSSIPPSEGTNFVAPAPVAPIKKPESISKQKTA
AESSESAKGSGAASSSTDKEKPKTETQPQKPKKTWELNNFDIGRLLGRGKFGNVYLAREK
ESQFVVALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYA
PQGTLFNALQAQPMKRFDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHKGVLK
IADFGWSVHEPNSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHAPFYS
KNYDETYKKILKVDYKLPEHISKAASHLISKLLVLNPQHRLPLDQVMVHPWILAHTQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatccgtccgaccatgtgctgcgccccaaggaaaatgctccagtcaggatgccg
gaaaaatcaactgccgtgctcaatacgcagaagaacttgctattgggaaagaagcccaac
agcgagaacgtggcgccaaccagcaaacccctgccaggatctactggcgctgtgatcagg
agtgcggcgaccaccgtgcgtccggcgaccaccgtgcgtccggcgaccaccgtgcgtccg
gcgacaaagccaggcctaggtgggtcatccatacctccatccgaaggaaccaacttcgtt
gctccagctccagtagcaccgatcaagaagcccgaatccatttccaagcagaagaccgct
gccgagagctcagaatccgcaaagggatctggtgcggccagcagcagcacagacaaagag
aaacccaagactgaaacccagccacagaagcccaagaagacctgggagctcaacaacttc
gatattggtcgcctgctggggcgcggcaagtttggcaacgtttatttggcgcgcgaaaag
gaatcacagttcgtggtggccctaaaagtgctgttcaagcgtcagattggcgagtccaat
gtggagcaccaggtgcgccgggagatcgagatacaatcgcacctgcgtcatccgcatatc
ctgcgtctgtacgcctactttcacgacgacgtgcgcatatatctgatcttggagtatgcc
ccacaaggaacgctgttcaatgccttgcaggcacagcccatgaagcgttttgatgagcgt
cagtcggccacctatattcaggcgttgtgctcggcgctgctctatctgcatgagcgggac
atcatccacagggatatcaagccggagaacttgctgctcgggcacaagggcgtcctgaag
attgcagactttggctggtccgtgcacgagccgaactccatgcgcatgacactgtgcggc
accgtcgactatttgccacctgaaatggttcagggcaagccgcacacgaaaaacgtagat
ttgtggagcctcggtgtgctctgctttgagttgttggtgggccatgctcccttctactcg
aagaactacgacgagacctacaagaagattctcaaggtggactacaaactgccggagcac
atttccaaggcagcttcacatctcatttccaagctgctggtccttaatccgcagcaccgc
ctaccgctggatcaggtgatggtgcacccatggatcctggcgcacacgcagtga

DBGET integrated database retrieval system