KEGG   Drosophila yakuba: Dyak_GE26154Help
Entry
Dyak_GE26154      CDS       T01068                                 

Definition
GE26154 gene product from transcript GE26154-RA
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dya  Drosophila yakuba
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dyak_GE26154
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dyak_GE26154
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dyak_GE26154
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dyak_GE26154
   00511 Other glycan degradation
    Dyak_GE26154
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dyak_GE26154
Enzymes [BR:dya01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dyak_GE26154
Exosome [BR:dya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dyak_GE26154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 637 aa AA seqDB search
MKLSAVVLVGLLPLLGAVSANRTFVVDYENDQFLKDGEPFRFIAGSFHYFRAHPATWQRH
LRTMRAAGLNAVTTYVEWSLHNPRDGVYAWSGIADLEHFIRLAVGEDLLVILRPGPYICA
ERDMGGFPYWLLNKYPGIQLRTADVNYLSEVRIWYTQLFAKVNKYLYGNGGPIIMVQVEN
EYGSFYACDLNYRNWLRDETESHVKGHAVLFTNDGPSVLRCGKIQGVLATMDFGATNDLK
PIWAKLRRYQPKGPLVNAEYYPGWLTHWTEPMANVSTQSITSTFINMLDHGASVNFYMFY
GGTNFGFTAGANEIGPGNYMADITSYDYDAPMTEAGDPTSKYQALRRITGRYLPLPKQPV
PGPVPKRSYGTVRLTTCCSLLSPEARTRLSTGFVQSAKPKSFEALGQYSGLVLYETWLPS
FQRDPSILSVPGLADRGYVYVDGEFVGILARETPVFELPISASAGRRLQIIVENQGRINY
GRQLNDFKGILRDVRLDKQVLSNWNMTQFPLESYDSLEQLISQSDEAVRQGFQELKNLRT
MLRTGPAIYHGQLDIQKKSELADTYLDMSGWGKGIVFLNGENLGRYWPLVGPQVTLYVPA
PVLKVGSNQLVVVEYQQTPTSQELHFRDNPILNARTV
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttagtgcggtggtcctggtgggtctacttccgctgctgggagctgtttcagcg
aatcgcactttcgtagtggactacgagaacgatcagttcctaaaggatggagaaccattc
cgatttattgccggctccttccactacttccgtgctcatccagccacctggcagaggcac
ctgaggacaatgagagccgcgggtctgaatgcagtgacaacctatgtggagtggtcgttg
cacaatccacgggatggcgtttatgcctggagtggcattgccgatctagagcacttcata
cgcctggccgtgggcgaggatctgctggtcatcctccgtccgggtccgtatatttgtgcg
gagcgtgacatgggcggctttccctactggctactcaataagtatcctggcattcaactc
cggacagcagatgtcaattatcttagcgaagttcgcatttggtatacccaactttttgcc
aaggtgaacaaatatctgtatggaaatggcgggccaattatcatggttcaggtggagaac
gagtatggctccttctatgcctgcgatctcaactatcggaattggcttcgcgatgagacc
gagagtcatgtcaaaggtcacgcggtgctcttcaccaacgatggacccagtgtgctgcgc
tgtggaaaaatccagggcgtcctagcgaccatggactttggagccacgaacgatctcaag
cccatttgggccaagcttagaaggtaccagccgaagggtccgctggtcaatgcggaatac
tatcccggctggctaacccactggacggagccgatggccaatgtcagcacccaatcgatt
acttccactttcataaacatgctggatcatggtgctagcgtaaacttctacatgttctac
ggcggcactaatttcggatttacagctggagccaatgagattggacccggaaactacatg
gcggacatcaccagctacgattacgatgcacccatgacggaggcgggggatcccacttcc
aaataccaggccctgcgacgtatcactggtcgctatctcccgctaccaaagcaacccgtg
cccggacccgttcccaagcgatcctacggaactgtgcgtctgaccacctgctgtagtctg
ctttcgccggaggcgcgaactcgtctctccactggctttgtgcagtccgccaagccgaag
agcttcgaggctttgggacagtattccggcctggtgctctacgagacctggttgcccagt
ttccaacgggatcccagcatcctgagcgtacccggcctcgcggatcgaggttacgtttat
gtggatggagagtttgtgggtattttggccagggagacacccgtattcgaattgcccatt
agtgcaagtgccggacggagactgcagatcatcgttgagaaccagggtcgcatcaactac
ggtcgtcagctgaacgactttaagggcattctgcgggatgtgcgactggacaagcaggtg
ctgagcaactggaacatgacccaattccctctcgagtcttacgacagcctggagcagctg
atttcgcagtcggatgaggcagttcgtcagggcttccaggagctgaagaacctgcgcaca
atgctgcgcactggtcccgccatctaccacggacaactggacatccagaagaagtcggaa
ctggcggacacctatctggacatgtccggctggggcaagggcattgtcttcctaaacggc
gaaaatctcggcaggtactggccactggtgggacctcaagtcaccctgtatgttccggca
cccgtgctcaaggtgggctcaaaccaactggtggtggtggagtaccagcagacacccacc
tcacaggagctgcacttccgggacaaccccatcctgaacgcgagaaccgtttag

DBGET integrated database retrieval system