KEGG   Drosophila yakuba: Dyak_GE26174Help
Entry
Dyak_GE26174      CDS       T01068                                 

Definition
GE26174 gene product from transcript GE26174-RA
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
dya  Drosophila yakuba
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 640 aa AA seqDB search
MNSKSDYEGEKEKKLTITNRFGDSLENYELSNESEHKTHVYPKKIPNRKNGILKNSETNH
SAVENPHLEDVDLADILGTNWPKRAGPAAMILNNKSKTDPSNSEDFILKPTSPILTKIEA
EEPLRFTIADYQPLIEIPGTELAIGSLVEVTNPGVCEDLYGVIRWIGIPPGPQKNVLVGI
EVEDESNLKNVVASDGRHNGVRLFTCHDGRAIFVPANRCTADRRFADVDNTIAANRVSSN
HAKKFGVADCPAIYGSIPPLEIHNSDELASICGKFKGIQGHHNSCYLDATLFSMFTFTSV
FDSILYRRPGPQDIRNYSEVQKVLRDEIVNPLRKNVFVRSDRVMKLRELLDQLSSVSGLT
CEEKDPEEFLNSLLSQIMRVEPFLKLSSGQDSYFYQLFVEKDEKLTLPSVQQLFEQSFHS
SDIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLDVTDIIENSPRQCSLCGKLAEYECR
DCFGSLQAGSGLECTAFCPKCLKTFHSHIKRTNHVSKKIYSPKEFKIMAEHMVVPRLYME
LFAVVCIETSHYVAFVKSGSGPDAPWCFFDSMADRKGEQNGYNIPEITCVPELTQWLSEE
GARSINETSTNDKVLPEHAKRIFCDAYMCLYQSTDIMMYH
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgaattccaaatccgattatgaaggagaaaaagaaaaaaagttgaccataacaaataga
ttcggggattccctggaaaactatgaactatccaacgagagcgagcacaagacccatgtt
taccccaaaaagattcctaaccgaaaaaatggaattttaaaaaacagcgaaacaaaccat
agtgccgtagaaaatccccatctcgaggatgtggacttggcagacattttgggcacaaat
tggccaaaacgagcgggaccagctgcaatgattttaaacaacaaaagtaaaacggatcct
agcaattctgaagacttcattttaaaaccaacgtctcccatattaacaaaaatagaagca
gaggaacctttacgttttacaatcgctgattaccaacctctgattgaaatacctggaact
gagctagcgattggttcccttgtagaagtcacgaatcccggagtatgtgaagatttatat
ggcgttataagatggataggtatacctcctggcccccaaaaaaacgtactcgttggaatc
gaggtagaagacgaatccaacttgaaaaatgttgtggcatcggatgggcggcacaatggc
gtacgcttatttacttgccacgatggtcgagctatttttgtaccagccaacagatgcacc
gctgaccggcgatttgctgatgtagataataccattgctgcaaacagagtttccagtaat
catgcaaagaaatttggcgtcgctgactgccctgctatttatggctcgataccaccatta
gaaatacacaactccgatgagcttgcaagcatatgcggaaagttcaaaggaatacaagga
caccataattcctgctaccttgatgcaactctattttccatgttcactttcaccagtgtt
tttgattcaattctgtacagacgtccaggcccacaagatattcggaattacagtgaagtt
cagaaggttttgcgcgatgaaatcgtcaatccattgcggaaaaatgttttcgttcgatct
gatcgtgtaatgaagctgcgcgagctcctagaccagctaagttcggtcagcggtctcacc
tgcgaagagaaagatcctgaagagttcctaaatagtttgctctcacaaattatgcgagtt
gaaccgtttttaaagctaagctcgggacaagattcatatttttaccaactttttgtggaa
aaggatgagaaattaacattaccgagtgtgcaacaactgtttgagcaaagtttccactca
tcggatataaaactaaaggaagttccttcttgttttattattcaaatgcctcgtttcgga
aagaactacaagatgtatccaagaatcttgccatcgcaggttcttgatgtcacagatata
attgaaaattctcctcgacagtgctcactttgtggcaaactagctgaatacgagtgccgg
gattgttttggtagcttgcaggctggatcagggctggaatgcaccgctttttgtcctaaa
tgtctgaaaacatttcacagtcacatcaaaagaacaaatcatgtgtcgaaaaagatttat
agtccaaaggaatttaaaatcatggccgagcacatggttgtgccgcgattgtacatggag
ttatttgctgtcgtctgcatagaaacgtctcattacgtggcgttcgtcaagtctggatcc
ggacctgatgctccatggtgtttcttcgattcaatggctgatagaaaaggcgaacagaat
ggatacaatatacctgaaattacgtgtgttccagaattaacacagtggctctcggaagag
ggcgcacgatctataaatgaaacttcaacgaacgataaagtattacctgaacacgctaag
cgtattttttgcgatgcctatatgtgtctgtaccaaagcacagatattatgatgtaccat
tag

DBGET integrated database retrieval system