KEGG   Drosophila yakuba: Dyak_GE26197Help
Entry
Dyak_GE26197      CDS       T01068                                 

Gene name
Dyak_Desat2, Desat2, GE26197, dyak_GLEANR_9760
Definition
(RefSeq) Desaturase 2 (EC:1.14.19.-)
  KO
K00507  
stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
dya  Drosophila yakuba
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dyak_GE26197 (Dyak_Desat2)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dyak_GE26197 (Dyak_Desat2)
Enzymes [BR:dya01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Dyak_GE26197 (Dyak_Desat2)
Lipid biosynthesis proteins [BR:dya01004]
 Desaturase
  First
   Dyak_GE26197 (Dyak_Desat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 358 aa AA seqDB search
MAPYEPSSNSSKQTGVLFEGDAETADGDLTSDRFQLKRAENRRLDLVWRNIILFALVHLS
ALYGLYSIFTKAKLATTLFAAGLYIIGMLGVTAGAHRLWAHRTYKAKWPLRLILVIFNTV
AFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFSHVGWLLCKKHPDIKEKGKGLDLSD
LRADPILMFQRKHYYILMPLACFVLPTVIPMVYWNETLASSWFVASMFRWCFQLNMTWLV
NSAAHQFGNRPYDKTMNPTQNAYVSAFTFGEGWHNYHHSFPWDYKTAEWGRYSLNITTAF
IDMFAKIGWAYDLKTVAPDMIQRRVLRTGDGSHELWGWGDKDLTPEDARNVLFVDKRS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggctccctatgagccctcttctaattcttccaaacaaacgggtgtcctattcgaaggc
gatgcggaaacagccgacggagacctcactagcgatagattccagttgaaacgagcagaa
aaccgtcggcttgatctggtctggcggaatataatcctgttcgctttggtgcacctgtct
gcactatatggcctctactccatattcacaaaggcgaaactcgccaccacactttttgct
gccggattgtatatcattggcatgctgggcgttacagccggtgcccatcgcctttgggcg
catcgcacctacaaggccaagtggcccctccgcctgatcctggtcatcttcaacacggtc
gcctttcaggatgccgcctaccactgggcccgtgaccatcgcgtccaccacaaatactcg
gagactgatgccgatccgcacaacgccacccgtgggttcttcttctcgcacgtcggctgg
cttctgtgcaagaaacatccggatatcaaggaaaagggaaagggactggacctttccgac
ctgcgcgccgatcccattttaatgttccagcgaaagcactactatatcctcatgcccctg
gcgtgctttgttctgcccactgtcattccaatggtttactggaatgagacactggcctcc
tcctggttcgtggccagcatgttcaggtggtgcttccagctgaacatgacctggttggtg
aacagtgcggcccaccaattcggaaatcgtccatacgacaagaccatgaatcccacccag
aatgcttatgtatcggcctttacgtttggcgagggatggcacaactaccatcattccttc
ccatgggactacaagacggccgaatggggtcgctactccctgaacataaccacggccttc
atcgacatgttcgccaagatcggctgggcctacgacctcaaaacggtggctcccgacatg
atccagcggcgggtactccgcactggcgacggttcccacgagctgtggggctggggcgat
aaggacctgacaccggaggatgccaggaacgtgctcttcgtcgataaaagatcataa

DBGET integrated database retrieval system