KEGG   Drosophila yakuba: Dyak_GE26198Help
Entry
Dyak_GE26198      CDS       T01068                                 

Gene name
Dyak_desat1
Definition
GE26198 gene product from transcript GE26198-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dya  Drosophila yakuba
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dya01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dya01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 383 aa AA seqDB search
MPPNAQAGAQSISDSLIAAASAAADSGQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM
KKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTVITAYLLYVVSGLGITAGAH
RLWAHRSYKAKWPLRVILIIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS
HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMLLMPIACFIIPTVVPMYAWGE
SFVNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY
HHVFPWDYKTAEFGKYSLNFTTGFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW
GWGDVDQPKEEIEDAVITHKKSE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaacgcccaagccggtgcccagtccatctcggactcgctgatcgcagcagct
agtgccgccgccgactcgggtcagagccccaccaagctgcaggaggactccaccggagtg
ctcttcgagtgcgatgtggagaccaccgatggtggacttgtcaaggacatcaccgtcatg
aagaaggccgaaaagcgccgcctgaagctggtctggcgcaacatcatcgccttcggttac
ctccatctggctgccctctacggagcctaccttatggtcacttccgccaagtggcagacc
gtcataaccgcatatctactatatgtcgtttctggcctgggtattaccgctggtgcccat
cgtctttgggcgcatcgctcctacaaggccaagtggccactgcgagtgattctgatcatc
ttcaacacgatcgccttccaggatgccgcctaccactgggcccgtgaccatcgcgtccac
cacaaatactcagagactgatgccgatccacacaacgccacccgtggtttcttcttctcg
cacgtcggctggctgctgtgcaagaagcacccggaggtgaaagccaagggcaagggtgtc
gatctatccgacctgcgcgccgatcctatcctcatgttccagaagaaatactacatgctt
ttgatgccaattgcttgcttcattatcccgaccgtggtgcccatgtacgcctggggcgaa
tcgttcgtgaacgcctggtttgtggccaccatgttccgctggtgtttcatcctgaacgta
acctggctggtaaacagtgctgcccacaagttcggtggtcgtccctacgacaaattcatc
aatccttcggagaacatctcggtggctatcttggccttcggagagggatggcataactac
caccacgtcttcccctgggattacaagacggctgagttcggaaaatactcgctaaacttc
actaccggcttcatcgatttcttcgccaagatcggctgggcctacgacctcaagacggtg
tccacggacatcatcaagaagcgagtgaagcgtaccggtgacggcactcacgccacgtgg
ggatggggcgatgtagaccagcccaaggaggagattgaggatgctgtcattacacacaaa
aagagcgaatag

DBGET integrated database retrieval system