KEGG   Drosophila yakuba: Dyak_GE26274Help
Entry
Dyak_GE26274      CDS       T01068                                 

Definition
GE26274 gene product from transcript GE26274-RA
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
dya  Drosophila yakuba
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dyak_GE26274
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dyak_GE26274
   04391 Hippo signaling pathway -fly
    Dyak_GE26274
   04068 FoxO signaling pathway
    Dyak_GE26274
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dyak_GE26274
Protein kinases [BR:dya01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dyak_GE26274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 372 aa AA seqDB search
MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQ
NVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMD
LDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMM
TPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLG
TPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKM
LVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVM
DYEAHNTNNRTR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagctcagcaccaacactacaccgtcgaggtgggagacaccaacttcaccatc
cacagtcggtacattaacctacggcctataggatctggtgcccagggaatagtatgcgcc
gcttacgatactatcacccagcagaatgtggcgattaagaaactatctcgaccattccaa
aatgtgacccatgccaagagagcatatagggagttcaagctaatgaagcttgttaaccat
aaaaacataattggcttacttaatgcttttacgccgcaaaggaacttggaggagtttcag
gatgtctaccttgtcatggagctgatggatgctaatctctgccaggtcatccaaatggac
ttggatcacgacagaatgtcttatttgctttaccaaatgttgtgcggaataaaacattta
cactcagcaggaattattcacagagacttaaagccatccaatatagttgtaaaggcagac
tgcactctaaagattttagactttggtctggcacgtactgcaggaactaccttcatgatg
actccctatgtggtcacccgatactacagggctccggaggtcattttgggcatgggatac
accgagaacgtggacatatggtccgttgggtgcatcatgggcgaaatgattaggggcggt
gtgctgtttcctggaacggatcatatagatcagtggaataaaattattgagcaattaggt
acaccatcaccctcatttatgcagcggttacagccaaccgtccgaaactatgtggaaaat
cgtcctagatacactggatactcatttgatagacttttccccgatggcttgtttcccaat
gataataatcagaatagccgcaggaaggcttctgacgctagaaatcttcttagtaaaatg
ctagtcattgatccagagcagcggatatctgtggacgaggctttgaagcacgaatatatc
aatgtgtggtatgatgctgaggaagtggatgctcccgctccggagccatacgatcacagt
gtagacgagagagaacacactgtggagcagtggaaggagctaatctatgaggaagtcatg
gactacgaagcacacaacacaaataatagaacgcggtag

DBGET integrated database retrieval system