KEGG   Drosophila yakuba: Dyak_GE26274Help
Entry
Dyak_GE26274      CDS       T01068                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
dya  Drosophila yakuba
Pathway
dya04013  MAPK signaling pathway - fly
dya04068  FoxO signaling pathway
dya04137  Mitophagy - animal
dya04140  Autophagy - animal
dya04141  Protein processing in endoplasmic reticulum
dya04214  Apoptosis - fly
dya04215  Apoptosis - multiple species
dya04310  Wnt signaling pathway
dya04391  Hippo signaling pathway - fly
dya04624  Toll and Imd signaling pathway
dya04933  AGE-RAGE signaling pathway in diabetic complications
Module
dya_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:dya00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dyak_GE26274
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dyak_GE26274
   04310 Wnt signaling pathway
    Dyak_GE26274
   04391 Hippo signaling pathway -fly
    Dyak_GE26274
   04068 FoxO signaling pathway
    Dyak_GE26274
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dyak_GE26274
   04137 Mitophagy - animal
    Dyak_GE26274
  Cell growth and death
   04214 Apoptosis - fly
    Dyak_GE26274
   04215 Apoptosis - multiple species
    Dyak_GE26274
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    Dyak_GE26274
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dyak_GE26274
Enzymes [BR:dya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dyak_GE26274
Protein kinases [BR:dya01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Dyak_GE26274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like APH RIO1 Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 6527987
NCBI-ProteinID: XP_002089054
FlyBase: FBpp0271284 FBgn0243305
UniProt: B4NZ71
Position
2L
AA seq 372 aa AA seqDB search
MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQ
NVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMD
LDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMM
TPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLG
TPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKM
LVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVM
DYEAHNTNNRTR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagctcagcaccaacactacaccgtcgaggtgggagacaccaacttcaccatc
cacagtcggtacattaacctacggcctataggatctggtgcccagggaatagtatgcgcc
gcttacgatactatcacccagcagaatgtggcgattaagaaactatctcgaccattccaa
aatgtgacccatgccaagagagcatatagggagttcaagctaatgaagcttgttaaccat
aaaaacataattggcttacttaatgcttttacgccgcaaaggaacttggaggagtttcag
gatgtctaccttgtcatggagctgatggatgctaatctctgccaggtcatccaaatggac
ttggatcacgacagaatgtcttatttgctttaccaaatgttgtgcggaataaaacattta
cactcagcaggaattattcacagagacttaaagccatccaatatagttgtaaaggcagac
tgcactctaaagattttagactttggtctggcacgtactgcaggaactaccttcatgatg
actccctatgtggtcacccgatactacagggctccggaggtcattttgggcatgggatac
accgagaacgtggacatatggtccgttgggtgcatcatgggcgaaatgattaggggcggt
gtgctgtttcctggaacggatcatatagatcagtggaataaaattattgagcaattaggt
acaccatcaccctcatttatgcagcggttacagccaaccgtccgaaactatgtggaaaat
cgtcctagatacactggatactcatttgatagacttttccccgatggcttgtttcccaat
gataataatcagaatagccgcaggaaggcttctgacgctagaaatcttcttagtaaaatg
ctagtcattgatccagagcagcggatatctgtggacgaggctttgaagcacgaatatatc
aatgtgtggtatgatgctgaggaagtggatgctcccgctccggagccatacgatcacagt
gtagacgagagagaacacactgtggagcagtggaaggagctaatctatgaggaagtcatg
gactacgaagcacacaacacaaataatagaacgcggtag

DBGET integrated database retrieval system