KEGG   Drosophila yakuba: Dyak_GE26285Help
Entry
Dyak_GE26285      CDS       T01068                                 

Definition
GE26285 gene product from transcript GE26285-RA
Orthology
K16172  
insulin receptor substrate 1
Organism
dya  Drosophila yakuba
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dya00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dyak_GE26285
   04150 mTOR signaling pathway
    Dyak_GE26285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L
AA seq 949 aa AA seqDB search
MASISDDGMALSGYLKKLKTMKKKFFVLYEETSHSAARLEYYDSEKKFLQRAEPKRVIYL
KNCFNINRRLDTKHRFVIVLSSRDGGFGIVLENENDLRKWLDKLLVLQRNIANSNGTAHS
PYDQVWQVVIQKKGISEKVGITGTYHCCLTSKSLTFVCIGPEKTPNGEDRVASIEILLTT
IRRCGHASPQCIFYVELGRQSVLGSGDLWMETDNAAVATNMHNTILSAMSAKTESNTNLI
NVYQNRPDLSHEPMRKRSSSANEASKPINVNVIQNSQNSLEFRSCSSPHNYGFGRERCDS
LPTRNGTLSESSNQTYFGSNHGLRSNTISGNRPHSTNKHSNSPTFTMPLRCSESEESSIS
VEESDDNGSYSHYRLNTRTSETAIPEENIDDFASAEFSKVTEPNESDENYIPMTPINPTD
AIHEKEKIDMQRLEDASLHFDFPEHASEKLAKDYDLDSDNQCVRPIRAYSIGNKVEHLKF
NKRLGHLNDTGQNPNRVRAYSVGSKSKIPRCDLQRVVLVEDNKHEFVANRSQSSITKEGS
GYGTSGNRQKKSTSAPLLSLKNQINSDRMSDLMEIDFSQASNLEKQKFIKNNEIPKYIEN
VFPKTPRTDSSSLTLHATSQKDIFNGTKLNNTANTSEDGYLEMKPVGNAYTPSSNCLPIK
VEKLKLSDYTAPLTTAAPVHDLNKISTYNISAEKWREQTTSEEKKSNSPLNEKPFSLKPT
NVENISHDVHSTNNIDCEQVSVQSDKQNNLDDKIVENNNLDIGGHEEKKLVHSISSEDYT
QIKDKSNDFTKFNEAGYKILQIKSDSSLISSKLYQKGIHKDNLERSHRLTESVNTIPDNA
TASSSVTKFNINAKAADSRSTDPSTPQNILQIKDLNFPSRSSSRISQPELHYASLDLPHC
SGQNPAKYLKRGSRESPPVSACPEDGNTYAKIDFDQSDSSSSSSNIFNT
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaatatcggatgacggcatggcgctgagtggctaccttaagaagttgaagacc
atgaagaagaagtttttcgtgctgtacgaggagaccagccattcggcagcccgtctggaa
tactacgatagcgaaaagaagttcctgcaaagagccgagccaaaaagggttatctatctg
aagaattgcttcaacattaaccgccgcttggacactaagcacagatttgtcattgtgctc
tcctccagagacggtggattcggcatcgttctcgagaacgaaaatgatttacgcaaatgg
ctggacaaactactagttctacaaagaaacatagccaattcgaatggaacagcgcactca
ccttatgaccaagtttggcaagttgtcattcaaaagaagggtatttcggagaaagtagga
atcaccggaacctaccactgttgccttacttcaaaatccctgacattcgtgtgcatagga
ccggagaagactcccaatggggaggatcgcgttgccagcattgaaatactgttgaccacg
atcaggcgatgtggtcatgcatcgccacaatgtattttctacgtggagctcggacgccaa
agtgtcttgggatcgggcgatctgtggatggaaacggataacgcagctgttgctactaat
atgcacaacactatactaagcgctatgtcagctaaaacagagtccaacacgaatttaata
aatgtttatcagaaccgacctgacttgagtcatgagcccatgagaaagcgatcatcgtct
gcaaacgaggcttcgaagccgataaacgtaaacgttatacaaaatagtcaaaactctctc
gaattccgtagctgcagttcgccccataactatggttttggaagagagagatgcgatagc
ttaccaaccagaaatggaaccctaagcgagtccagcaatcaaacatactttggttccaac
catggactgcgatccaacactatatctggcaaccgtccgcactcaaccaacaagcatagt
aatagtccaacgttcaccatgccattaagatgctcagaatctgaagagtcatcaattagt
gtcgaagaatccgacgacaacggaagttatagccactacagattaaacacgcggacgtcg
gagactgctattcctgaggagaacattgatgactttgccagtgcggaatttagcaaagtc
accgaaccaaatgaaagtgacgaaaactacataccgatgactccaattaatcctaccgat
gctattcatgaaaaagagaagattgacatgcagagattggaagatgcatctctgcatttt
gactttccggagcacgcatcggaaaaacttgctaaggattatgatctggactctgataac
caatgcgtacgtcccattcgtgcctattcgataggaaacaaagttgagcatttaaagttt
aataagcgcctgggacatttgaatgatacgggtcagaatccgaatcgcgtgcgagcctac
tcggttggttccaagtcgaagataccgcggtgcgacttgcagcgagtggtccttgtggag
gataataaacatgagttcgtagcgaatagaagtcagagtagcattacgaaggaaggatcc
ggctatggcacaagtggcaaccggcaaaagaaatctacaagtgctccactccttagtctg
aagaatcagataaactctgaccgaatgagtgacttaatggaaattgatttttcacaagca
tccaatttggaaaagcaaaagttcatcaaaaacaatgaaattccgaaatacattgaaaac
gtgttcccaaaaacccccagaaccgatagctccagcttaactctgcacgccacaagtcag
aaagacattttcaatggaaccaaattaaataacactgcgaacacatccgaggatggatac
cttgagatgaagccagtcggtaatgcatacactcccagttcgaattgccttccaattaaa
gtagagaagctcaagctatcagactacaccgcaccactcacaacagcagcgccagtgcac
gacttaaacaaaattagcacatacaatatatccgctgagaaatggagagaacagacaaca
agcgaggagaaaaagtcgaactcgccattgaatgaaaaaccctttagcttaaaaccaaca
aatgtcgagaatatcagccacgatgtgcattcaacaaacaacattgactgtgagcaagtg
tctgtgcaaagcgacaaacaaaataacttggatgacaagattgttgaaaataacaatttg
gatattggcggccatgaggaaaagaaattggttcattcgataagcagtgaagattacact
caaatcaaggacaaatcgaatgacttcacaaaatttaacgaagccggctacaaaattttg
caaattaaaagcgacagctcactcatctcatccaagctataccaaaagggtattcacaaa
gataacttggagcgatcgcatagactcacggagagcgttaatacgattcctgataatgcc
accgccagcagctcagtgaccaaattcaatataaacgcaaaagcagctgactcgcgaagc
acagatccaagtacgccacaaaacattcttcagataaaagatttgaatttcccatcaagg
tcttcatcgcgcatatcccagccggagctgcactacgccagccttgatcttccccattgc
agcggccaaaacccagctaaatacctgaagagaggttcccgcgaatctccgcccgtgtct
gcatgcccggaggatggaaatacctatgcgaaaattgactttgaccaatcggactcctct
tcctcctcatcaaacatatttaatacgtaa

DBGET integrated database retrieval system