KEGG   Drosophila yakuba: Dyak_GE26410Help
Entry
Dyak_GE26410      CDS       T01068                                 

Definition
GE26410 gene product from transcript GE26410-RA
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
dya  Drosophila yakuba
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dya00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dyak_GE26410
Enzymes [BR:dya01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Dyak_GE26410
Glycosyltransferases [BR:dya01003]
 Polysaccharide
  Storage polysaccharide
   Dyak_GE26410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 709 aa AA seqDB search
MRRQQSYRFEDNESTSYALRMNRRFSRVESGADLKDYFDRGDIASRENRWNFEVAWEVAN
KVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEMEFPRGNPLLDAVNSLRSR
GYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFM
IAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLL
GRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHL
LKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIA
GRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQL
RDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVA
DDWNDPVLSSIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYY
EPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSS
FMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYPDYVDELSLYGS
KNNLIFSRPHSEPPSPTSSRHTTPAPSVHGSDDEDSVDEETELKELGIK
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagacagcagtcctaccgattcgaggacaatgagtccacctcctacgccctgagg
atgaatcgtcgcttttcgagagtggagtccggggcggacctgaaggattatttcgatcga
ggtgacatcgcctcccgggagaatcgctggaacttcgaggtggcatgggaggtggccaac
aaggtgggcggcatttacacggtgatccggtcgaaggcctatgtctccaccgaggagatg
ggtgagcagctgtgcatgatgggtccctacaaggagcattgtgcccggaccgagatggag
gagatggaattccccaggggaaatcccctgctagatgctgtcaactccttgcgctcgcga
ggctataaaatccacaccggtcgttggctggtggacggaaatccccaactgatcctgttt
gatattggatccgctgcctggaagttggaccagttcaaatcggagatgtgggagaagtgc
catattggaatacctcatttggatatcgagacgaacgatgccatcatcctgggctttatg
attgccgagttcctggaggagttccgcaactttgccgtaacttattcccaaaacaacgaa
ctgagtgccccgaggattgtcgcccacttccacgaatggcaagctggcgtgggtctcatt
gtcctacgtactcgtctggtggagattgccaccgtgttcaccacccatgccacattgttg
ggtcgctacttgtgcgccggcaacaccgatttctacaacaacctggacaagttcgccgtg
gacgaagaggcgggcaagcgacagatctaccatcgctattgcctggagcgaggtgccacc
cacttggctcacgtgttcaccaccgtctcggagattacgggctacgaggcagagcatctg
ctcaagcgcaagccggacatcatcacgccgaacggattgaacgtgaagaagttctcggcc
atccacgagttccagaatttgcatgccgttgccaaggagaagatcaacgaattcgtgcgg
ggccatttctacggccacattgactttgatttggataagaccttgtacttctttatcgcc
ggtcgctacgagttcggaaataagggagccgacatcttcatcgaggcactggctcgcctg
aatgcgatgctgaagcacgagaagccggacaccacggtggtagccttcctcatcttcccc
accaagaccaacaacttcaacgtggactcgctgcgaggacatgccgtgatcaagcagttg
cgcgatacgatcaacaatgtccaacaggccgtgggcaagcggatgttcgacacctgcctg
cagggcaacatccccaatgccgatgatctcctccagaaggacgacctggtcaagatcaag
cgttgcatgttcgccatgcaacgcgattcgatgccgcctgttaccacgcacaatgtggcc
gatgattggaacgatccggtgctatcctcgatccgtcgttgccatctgttcaactcgcgc
cacgatcgcgtcaagatggtcttccatccggagttcctcacatccacaaaccctctgttt
ggaatcgactacgaagagtttgtccgtggctgccacttgggtgtcttcccctcatactac
gagccctggggctacactcccgccgagtgtacggtgatgggaattcccagcgtaaccacc
aatctgtccggtttcggctgcttcatggaggagcacatcagtgatcccaagtcctacggc
atctacatcgtggatcgccgctatatcggattggagaacagcgttcagcagctgtccagc
ttcatgatggaattctccaggctgaaccgtcgccagcgcatcatccagcgtaatcgcacg
gagcggttgagcgatctgctggactggcgcaccctgggcatttactacagacaggccagg
gttaaggccctgcaggctgtttacccagactatgtggatgaattgtccctctatggatcg
aaaaacaacttgatcttctcgcgaccgcacagtgaacctcccagtccgacttcatcgcgc
cacaccacaccagctccatcggttcacggttcggatgatgaggactccgtggacgaggag
accgaactcaaggaattgggcatcaagtag

DBGET integrated database retrieval system