KEGG   Dickeya zeae: Dd1591_0024Help
Entry
Dd1591_0024       CDS       T00930                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dze  Dickeya zeae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd1591_0024 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd1591_0024 (glk)
   00052 Galactose metabolism
    Dd1591_0024 (glk)
   00500 Starch and sucrose metabolism
    Dd1591_0024 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Dd1591_0024 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dd1591_0024 (glk)
   00524 Butirosin and neomycin biosynthesis
    Dd1591_0024 (glk)
Enzymes [BR:dze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dd1591_0024 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
27141..28109
Genome map
AA seq 322 aa AA seqDB search
MHQYALVGDVGGTNARLALCELANGKLSHSKQYAVQQHDSLEEAIRLFLAEHAELTIKEA
CIAIACPVTDDWVEMTNHHWAFSIAAMRQSLGFERLAVINDFTAVSMAIPALTQEDVIQL
GGAAPVAGKPVAVYGAGTGLGVAHLLPVDGKWLSLPGEGGHVDFAPNSEEEDILLQVLRQ
ELGHVSAERVLSGPGLVNIYRAIVKADDRVPEALTPQIVSERALAHSDVDCLRALSLFCV
LMGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFRNSGFRSAFEDKGRFRDYLADIPVFMI
SHPQPGLLGAGAYLRQALGQTL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagtatgcgctggtaggtgacgtcggtggcaccaacgcacgtcttgcgctgtgt
gaactggcgaatgggaagttgtcgcacagcaagcagtacgcggttcagcagcatgacagt
ctggaagaggcgattcgcctgtttctggcggaacacgcggagctcaccatcaaagaagct
tgtattgccatcgcctgcccggtgaccgacgactgggtggagatgactaatcatcactgg
gcgttttcgattgccgccatgcggcagagcctggggtttgaacgcctggcggtgatcaac
gactttaccgccgtcagcatggcgattccggcgttgacgcaggaagatgttattcaactg
ggtggcgcagcgcccgtcgcgggcaagccggtggcggtatacggtgccggaaccgggctc
ggcgtggcgcacctgttaccggtggacgggaaatggctcagcctgccgggcgaaggcggt
cacgtcgattttgcgccgaatagcgaagaagaggacatcctgttgcaggtgttgcgtcag
gaactgggacatgtctccgccgagcgcgtgctgtccggaccggggctggtgaatatttac
cgggcgatcgttaaagcggacgaccgggtgccggaagcgctgacgccgcagatagtgtct
gaacgggcgctggcgcacagcgatgtcgactgtctgcgtgcgttgtcgctgttttgcgtg
ctgatggggcgctttggcggcaatctggcgctgaatctcggcaccttcggcggcgtttat
atcgccggcggcattgtgccgcgttttctggaattcttccgcaactccggttttcgtagc
gcgtttgaagacaaaggccgcttccgtgattatctggccgatattccggtgttcatgatt
tctcacccacagccagggttgctgggtgcgggcgcgtatttgcgtcaggcattgggccag
acgctgtaa

DBGET integrated database retrieval system