KEGG   Dickeya zeae: Dd1591_0108Help
Entry
Dd1591_0108       CDS       T00930                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dze  Dickeya zeae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dd1591_0108
Enzymes [BR:dze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dd1591_0108
Exosome [BR:dze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dd1591_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(126345..127856)
Genome map
AA seq 503 aa AA seqDB search
MNQEKKYIVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPKAGWVEHDPMEIWATQSS
TLVEVLAKAGISSDEVAGIGITNQRETAVVWEKETGKPIYNAIVWQCRRSADICEKLKKD
GLEEYIRANTGLVVDPYFSGTKVKWILDHVEGSRERARRGELLFGTIDTWLIWKMTQGRV
HVTDYTNASRTMLFNIHKLDWDERMLDVLDIPRAMLPQVRPSSEIYGQTNIGGKGGTRIP
IAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFLLMNTGTEAVRSKHGLLTTIACGPRGEV
NYALEGAVFIGGASIQWLRDELKLIGDAMDSEYFATKVKDTNGVYVVPAFTGLGAPYWDP
YARGAIFGLTRGANANHIIRATLESIAYQTRDVLDAMQADADTRLQSLRVDGGAVANNFL
MQFQSDILGTRVERPQVRESTALGAAFLAGLATGFWNDLDEVKSKATIEREFRPSIETVE
RNFRYRGWQKAVARARAWEDHDE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaggaaaaaaaatacatcgtcgcgctcgaccagggcactaccagttcacgggct
gttgtgctggatcatgacgccaacatcgtcagcgtatctcagcgggagttcacccaaatt
taccccaaagcgggctgggtagagcacgacccgatggaaatctgggccacccaaagctcc
acgctggtagaagtgctggcgaaagccggcatcagcagcgacgaagtcgccggcatcggt
attaccaaccagcgtgaaaccgccgtggtatgggaaaaagagaccggcaaaccgatttat
aacgccattgtgtggcaatgccgccgttccgccgatatctgcgaaaaactgaaaaaagac
gggctggaagagtacatccgcgcgaataccggtctggtggtcgacccgtatttttccggc
accaaagtgaaatggatactcgatcacgtagaaggatcgcgtgaacgcgctcgccgcggc
gaactgctgttcggcactatcgatacctggcttatctggaagatgacgcaaggccgcgtc
cacgtcaccgattacaccaacgcttcgcgtaccatgctgttcaacatccataaactggac
tgggacgaacgtatgctcgacgtgctggacattccgcgcgccatgctgccgcaggtacgc
ccgtcttccgagatttacggccagaccaacatcggcggaaaaggcggtactcgcattcct
atcgccggtatcgccggcgaccagcaagccgccttgtacggccagctgtgcgtacagccc
ggcatggctaaaaacacctacggcaccggctgcttcctgctgatgaacaccggcaccgaa
gcggtacgttctaaacacggcctgttgactaccatcgcctgcggcccgcgcggcgaagtg
aactacgcgctggaaggggcggtattcatcggcggcgcgtcgatccaatggctgcgcgac
gaactgaaactgattggcgatgcgatggactccgaatacttcgccaccaaagtgaaagat
accaatggcgtctacgtggtgccggcgtttaccggtctgggcgcgccttactgggaccca
tacgcccgcggtgcgattttcggcctgacccgcggcgctaacgccaatcacatcatccgc
gccacgctggaatccatcgcctaccaaacccgcgacgtgctggacgcgatgcaggccgac
gccgatacccgcctgcagtcgctgcgcgtggacggcggcgccgtcgccaacaacttcctg
atgcagttccagtccgacattctgggtacgcgcgtagagcgtccgcaagtacgcgagtcc
accgcgttgggcgccgcgttcctggctggcctggctaccggtttctggaatgatctggac
gaagtgaagagcaaagccactattgagcgtgaattccgccccagcatcgaaaccgtggaa
cgcaacttccgctatcgcggctggcagaaagcggtagcacgcgcacgggcgtgggaagac
cacgacgaataa

DBGET integrated database retrieval system