KEGG   Dickeya zeae: Dd1591_0196Help
Entry
Dd1591_0196       CDS       T00930                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
dze  Dickeya zeae
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dze00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
236367..237359
Genome map
AA seq 330 aa AA seqDB search
MNPYPECLLTREWQYAAFVTGPLLDFWRQRQEGMFIGVDDVPIRFVRFTSPLHQHLVVVL
PGRTDSYVKYAEVAYDLFQCGYDVLMMDHRGQGRSGRLLKDRYRGHVKRFSDYVDDVATL
WQQQVAPGRYTKRFALAHSMGGAILAQFLARQPQAFDAVALCAPMCGILLPMPRWLAWRI
LDWAERHPAIRDYYAIGTSPWRPLPFMANVLTHSHARYRRHVRFYADDPDLRIGGPTYHW
VREALLVETQLLPQAAAITTPLLLLQAEEERVVDNRSQDAFCRALAAAGHPCADGRPYVV
RGARHDILSEKDAMRADAFGRILQHFNDYH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatccttatccggagtgcctgctgaccagagaatggcagtacgccgcatttgttacc
gggccgctgctggatttctggcgacagcgtcaggaagggatgttcatcggcgtggatgac
gtgcctatccgtttcgttcgttttacctcgccgttgcaccagcatctggtggtggtattg
cccggccgtaccgacagctacgtgaaatacgctgaggtagcctacgacctgtttcagtgc
ggttacgatgtgttgatgatggaccaccgtggtcaggggcgttccggccggttgctgaaa
gaccgttatcgcgggcatgttaagcgctttagcgattatgtggacgatgtggcgacgctg
tggcagcaacaggtggcgccggggcgctatacaaaacggttcgcgctggcgcattcaatg
ggcggtgcgattctggcgcagtttctggcgcgtcagccccaggcgttcgatgcggtggcg
ctgtgcgcgccgatgtgcggcatcctgctgccgatgccgcgctggctggcatggcgcatt
ctggactgggccgagcgccacccggcgatacgagactattatgccatcggcaccagcccg
tggcgtccgctgccgtttatggccaatgtgctgacccacagccatgcgcgctaccgtcgc
catgtgcgtttttatgccgacgacccggatttgcgtatcggcggcccgacttatcactgg
gtgcgggaagcattgctggtggaaacgcaactgttgccacaggcggcggcgatcacgacg
ccgttgctgctgttgcaggcggaagaagaacgggtggtggataaccgcagccaggacgcc
ttctgtcgggcgctggcggcagccggtcacccgtgtgcggacggccggccttacgtcgtt
cgcggtgcccgtcacgatattctgtcggaaaaggatgcgatgcgggccgacgccttcggg
cgaattttgcaacatttcaacgattatcattaa

DBGET integrated database retrieval system