KEGG   Dickeya zeae: Dd1591_0223Help
Entry
Dd1591_0223       CDS       T00930                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dze  Dickeya zeae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dd1591_0223
Enzymes [BR:dze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dd1591_0223
Exosome [BR:dze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dd1591_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
267334..269517
Genome map
AA seq 727 aa AA seqDB search
MSGFSDRNIINLLFSGHYADPFAVLGMHVTSSGLEVRALLPDASDVHVVDAHSGRKVAHL
QRLDPRGFFVAVIPRRKKPFSYRLAVTWQQDTHVIDDPYRFGPLLQELDIWLLAEGRHLR
PFETLGAHPSTLDGVGGTCFAVWAPNAQRVSVVGDFNFWDGRRHPMRLRCENGVWELFVP
GVGVGQLYKFEIIDCYGNVLVKSDPYAFASQMRPDTASVVSALPPALPVDEARQSANDLQ
SPISIYEVHLGSWRRHDDNNFWLSYRELADQLVPYVKDMGFTHVELMPVHEHPFDASWGY
QPLGLYAPTRRFGSPEDFRYLVSAFHEAGINVLLDWVSGHFPTDSYGLARFDGTALYEYA
DPKEGYHQDWNTLIYNFDRHEVRNYLAGNALYWTERFGVDGLRVDAVASMIYRDYSRRDG
EWVPNHYGGKENLEAIGFLRYTNQMLGQNRAGAVTIAEESTDYAGVTLPPEHSGLGFHYK
WNMGWMHDSLAYMQQDPVHRKYHHDLLTFGMLYAYSENFVLPLSHDEVVHGKRSLLDRMP
GDAWQKFANLRAYYGFMWAYPGKKLLFMGGEFAQGREWNHDTSLDWHLLDEPEGWHVGVQ
QLVRDLNHCYRQHPPLYQCDYLHQGFEWVVVDDRENSVFAFIRRDAEGNEILIISNFTPV
PREGYRVGINQPGHWREVLNTDSMHYHGSNLGNQGLVRSEAVGSHSRPQSLVLTLPPLST
LYLVKEA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggattttccgatcggaacatcattaatctccttttttccggccattacgccgat
ccttttgcagtattgggtatgcacgtcacctcgtcaggcttggaagttcgtgcgctgctt
ccggatgccagcgatgtacacgtggtagacgcacacagcggacgtaaagtcgcacacctg
cagcgcctggacccgcgcggttttttcgttgcggtgatccctcgtcgtaaaaaaccgttc
agctatcggctggcggtgacctggcagcaagatacgcatgtgattgacgacccttatcgt
tttggcccgttgttgcaggagctggatatctggctgctggcggaggggcgccatttgcgg
ccgtttgaaacattgggcgcgcatccgtccacgctggatggcgtcggcggcacctgcttc
gccgtctgggcgccgaatgctcagcgggtgtcggtggtgggtgatttcaatttttgggat
gggcgccgccacccgatgcggctgcggtgcgagaacggcgtgtgggagctgtttgtgccg
ggcgtcggggtcgggcagttgtacaaattcgaaatcatcgattgctacggcaatgtgctg
gtgaaatcagacccgtatgccttcgcttctcagatgcgaccggataccgcctcggtggtc
agtgcgttaccgcccgcgttgccggtggatgaggcgcggcaatccgccaacgatttacag
tcgccgatttccatttacgaggtgcatctggggtcatggcggcggcatgacgacaataat
ttctggctcagttaccgcgaactggcggaccaactggtgccgtacgttaaagacatgggg
ttcacccacgttgaactgatgccggtgcatgaacatccgtttgacgctagttggggttac
cagccgctggggctgtatgcaccgacccgccgcttcggctcgccggaggatttccgttat
ctggtcagcgcctttcatgaggcgggcatcaatgtgttgctggactgggtatccggccat
ttcccgacggacagctacggtctggcgcggtttgacggtacggcgctgtacgaatatgcc
gacccgaaagaaggttaccatcaggactggaatacgctgatttataacttcgatcgccat
gaggtgcgtaactatctggcgggtaacgcgttgtactggacggagcggtttggcgtcgac
gggttacgggtagacgcggtggcatcaatgatttaccgcgactacagccgccgcgacggc
gaatgggtgccgaaccattacggcggcaaggagaacctggaggcgatcggctttttacgt
tacaccaaccagatgctgggccagaaccgtgccggagccgtcaccatcgccgaagagtcc
accgattatgccggggtgacgttgccgccggaacatagcgggttgggttttcactataag
tggaacatgggttggatgcacgactcgctggcctacatgcaacaggatccggtgcatcgt
aaataccaccacgacctgctgaccttcggcatgttgtatgcctacagcgagaacttcgtc
ctgccgctgtcgcacgatgaagtggtacacggcaaacgttctttgctggataggatgccg
ggcgacgcctggcagaaattcgccaacctgcgtgcctattacggctttatgtgggcttat
cccggcaagaagctgctgtttatgggcggcgagtttgcacaaggacgggaatggaaccac
gacaccagcctggactggcacctgctggatgagcccgaaggctggcatgtcggcgtgcag
caactggtgcgcgacctcaaccattgttatcgccaacacccgccgctctatcaatgcgac
tacctgcatcagggatttgaatgggtggtggtagacgatcgcgagaactcggtattcgcc
tttatccggcgtgatgccgagggcaacgagatattgattatcagcaactttacgccggtc
cccagagagggatatcgcgtcggcattaaccagccgggacactggcgcgaagtgctgaat
accgattccatgcattaccacggtagtaaccttggcaatcagggattagtgcgtagcgaa
gcggtgggcagccattcccgcccacaatcgctggtgttaacgctgccgccgctctccacc
ttgtatctggtgaaggaggcgtaa

DBGET integrated database retrieval system