KEGG   Dickeya zeae: Dd1591_0233Help
Entry
Dd1591_0233       CDS       T00930                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dze  Dickeya zeae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dd1591_0233 (malQ)
Enzymes [BR:dze01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Dd1591_0233 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
283785..285938
Genome map
AA seq 717 aa AA seqDB search
MALKAKKSVPHQMGIADTYKDAYGNERAIDNETRQALLQLLEVTEPSTAPLPSVCVLRQE
QQNRLPLRHAGDYVWTLTYEKGGIIEGRITGQAVLALPDNLPLGYHQLMLMQGEQQWPCR
VIVAPTRCYEPEPLTQGKRWWGVMVQLYTLRSSDNWGIGDFGDLKTLVEQVARRGGAFVG
LNPLHALYPAQPEAASPYSPSSRNWLNIVYIDVNQVDDFHQSDAARAWWKQDDIQQQLTA
ARANRWVDYTAVTRLKLAALRLAFSHFTNRNALDPRKTAFQQFLKTHDESLLQQATYDAL
QAWMHQQGKPTADWRQWPQEYHAARSDATLAFRQEHADDVQFYCWLQWLAHEQLAACFSH
SKQLGMPIGLYRDLAVGVAQGGVDTWGDQQLYCMSVTIGAPPDPLGPGGQNWNLTPVHPT
LLRQRGYQPFIDLLRSNMAHSGALRIDHVMGLLRLWWILNGNDATHGAYVFYPVDDLLGI
LALESHRHRCLVIGEDLGTVPEEIVNKLPDNSVYSYKVLFFEKDQQDRFRAPDEYPPRSM
ATITTHDLATLRGYWQGVDLTLGKDLGLYPDAAALQRQHEARECAKQGLLDALHEQALLP
QRVGRNASLTTMSAQLNRGVQRYLADSASALLGLQLEDWLDMSTPVNVPGTDQEYPNWRR
KLSRPLDSIFTDRYLERLIRDIDLRRGGPVPSRSKKTVKPAETPVDNGKQKETKKPE
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaaagcaaaaaaatccgtaccccaccagatggggatcgctgatacctataaa
gatgcttacggtaatgaacgggcgatagacaacgaaacccgccaggcattgctgcaactg
cttgaggtcactgaaccatcgacggcaccgttgccgtcggtatgtgtattgcgccaggag
cagcaaaatcgattgccgttacgtcacgcaggcgactatgtctggacgctaacctatgaa
aaaggcggcattatcgaagggcgcataactggtcaggcggtgttggccttgccggacaac
ctgccgctcggttatcaccagttgatgttgatgcagggcgaacagcagtggccttgccgg
gtgattgtcgccccgacgcggtgttatgaaccggaaccgctgacgcagggaaaacgctgg
tggggcgtcatggtgcagttgtataccctgcgttcgtccgataattggggcatcggcgat
tttggcgatttaaaaacgctggtagagcaggtggcgcgtcggggcggtgcctttgtcggt
ttgaatccgctacatgcgctttacccggcacagcccgaggccgccagcccgtatagcccg
tcttcgcgtaattggctgaatattgtctatatcgatgtcaatcaggtggatgattttcat
cagagtgatgccgcgcgcgcatggtggaaacaggacgatatccagcagcaactgacggcg
gcgcgcgctaaccgatgggtcgattataccgccgttacccgcctgaagctggcggcgctg
cgactggcgtttagccatttcaccaaccgcaatgcactggacccgcgtaaaacggcgttc
cagcagtttctcaaaacccacgacgaaagcctgttgcagcaggccacttatgatgcgtta
caggcgtggatgcaccagcagggcaaaccgaccgccgactggcggcaatggccgcaggaa
tatcacgctgcacgcagcgacgccacactggcattccggcaggagcacgccgacgatgtg
caattctattgttggcttcagtggctggcgcatgaacaactggcggcctgtttttcccat
agtaaacaattgggtatgccgatcggcttatatcgcgatttagcggtcggggtggcgcag
ggcggcgtggatacctggggcgaccaacagttgtattgtatgtcggtgacgatcggcgca
ccgccggacccgctcgggcctggtgggcaaaactggaacctgacgccggtgcacccgaca
ttgttgcgtcagcgcggttaccagccgtttatcgatttgctgcgcagcaatatggcgcat
agcggcgcgttgcgtatcgatcatgtaatggggttgctgcgcttgtggtggattctgaac
ggcaacgacgcgactcacggtgcctatgtgttttacccggtggatgacttgctggggata
ctggcgttggagagccatcgccatcgttgtctggtgatcggtgaagatcttggcacggtg
ccggaggagatcgtcaataaattgcccgacaacagcgtctattcctacaaggtgttgttt
ttcgagaaggatcagcaggatcgttttcgcgcgccggatgaatatccgccccgttcgatg
gcgaccatcaccacgcatgatctggcgacgctacgcggttactggcaaggggtcgatctg
accttaggcaaagatcttgggttgtatccagatgccgccgcgctgcagcgccagcatgaa
gcgcgtgagtgtgccaagcaggggctgctggatgcgctgcatgagcaagcgttgctgcct
caacgggtgggccgcaatgcatcgctgacgaccatgagcgcccagcttaatcgcggtgtg
cagcgttatctggcggacagcgccagcgcgttgctgggcttgcagcttgaagactggctg
gatatgtcgacgccggtaaatgtgccgggtaccgatcaggaataccctaactggcggcgt
aagttgagccgcccgctggattccattttcaccgaccgttatctggaaaggctgatcagg
gatatcgatctgcgccgcggcgggccggtgccgtcacgcagtaaaaagacggtcaaaccg
gcggagactccggtggataatggaaagcagaaagagacaaaaaagcctgagtga

DBGET integrated database retrieval system