KEGG   Dickeya chrysanthemi: Dd1591_0365Help
Entry
Dd1591_0365       CDS       T00930                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00620  Pyruvate metabolism
dze00630  Glyoxylate and dicarboxylate metabolism
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01120  Microbial metabolism in diverse environments
dze01200  Carbon metabolism
Module
dze_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dd1591_0365
   00630 Glyoxylate and dicarboxylate metabolism
    Dd1591_0365
Enzymes [BR:dze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dd1591_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACT05255
JGI: Dd1591_0365
UniProt: C6CI09
Position
407010..408608
Genome map
AA seq 532 aa AA seqDB search
MTQQTISRELVFTHALGDAEQQILTADAVNFLTVLVSRFTSQRNHLLAERREVQGRIDSG
ELPGFISEMDSIKNSDWKIRGIPSDLLDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWSKVIDGQINLRDAVRGTITYTSEAGKIYQLKPNPAVLICRVRGLHLPEKHVLWND
EPIPGSLFDFALYFFHNYRQLLAKGSGPYFYLPKTQSWQEAAWWGDVFSYTEDHFGLTRG
TIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQSV
TMDKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKEVERNAWVQEKVRQDKELEARNGH
DGTWIAHPGLADTVMPVFDRLLGERSNQLDVLREDDAPVTADELLAPCPGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHGKTLSDGRVVTKALFRQ
MLTEEMQVIRGELGDTRFDGGRFEEAARLMERITTQDALIDFLTLPGYDLLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacagacgataagcagggaactggtattcacccatgcattgggtgatgcagaa
cagcagattctgacggcggatgcggtgaattttcttacggtgctggttagccgctttaca
tcgcaacgcaatcacttgctggcggagcgccgggaggttcaaggccggatcgatagtggt
gagttaccgggttttatttcggaaatggattccataaaaaattcagactggaaaattcga
ggtattccatctgacttgctggatcgccgggtagagattaccggcccggtggaacgcaaa
atggtgattaatgccttgaatgccaatgtcaaagtctttatggcggactttgaagactcg
ctggcgcccagttggtcaaaggtgattgatgggcaaatcaacttgcgggatgccgtgcgc
ggcaccattacctataccagtgaggcgggaaagatttatcagctcaaacccaacccggcg
gtgttgatttgccgggtgcgcggcttgcacctgccggaaaaacacgtgctgtggaatgat
gagcctatccccggcagcctgtttgatttcgcactctatttttttcacaactaccgccaa
ttgctggcaaaaggcagcggcccgtatttttatttgccgaaaacccaatcctggcaggag
gccgcctggtggggtgacgtgttcagttataccgaagaccattttggcctgacgcgcggt
accatcaaagccaccgtgctgattgaaaccctgccggccgtgttccagatggacgaaatt
ctctatcacctgcgcgatcacatcgtcgggctgaattgtgggcgttgggattacatcttc
agttatatcaagacgttgaaaaatcatccggatcgggtattgccagaccggcagtcggta
accatggacaagccgttcctgagcgcttattcgcgtttgctgatcaaaacctgtcaccga
cgcggcgcgtttgcgatgggcggaatggccgccttcattcccagcaaagaggtggaacgc
aacgcctgggtgcaggagaaagtcaggcaggacaaggaactggaggcccgcaatggtcat
gacggcacttggatcgcccatcccggcctggctgatacggtgatgccggtgttcgatcgc
ctgctgggcgagcgttccaaccaactggatgtgttgcgcgaagacgatgcgccggtgacc
gccgacgaactgctggcaccttgtccgggagaacgtaccgaagccggtatgcgcgccaat
atccgcgtggcggtgcaatacatcgaagcctggatttccggcaatggctgcgtaccgatt
tacgggttgatggaagacgccgccaccgccgaaatctcccgcacctccatctggcagtgg
atccaccacggcaaaaccctcagcgatggccgcgtggtgaccaaagcgctgttccgccaa
atgctgaccgaagagatgcaggttatccgcggtgaactgggcgatacccgcttcgacggc
ggccgttttgaggaggcagcccgattgatggaacgcatcaccacgcaggacgcgttaatc
gattttctcaccttacccggttacgacttacttgattaa

DBGET integrated database retrieval system