KEGG   Dickeya zeae: Dd1591_0365Help
Entry
Dd1591_0365       CDS       T00930                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dze  Dickeya zeae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd1591_0365
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dd1591_0365
   00630 Glyoxylate and dicarboxylate metabolism
    Dd1591_0365
Enzymes [BR:dze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dd1591_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
407010..408608
Genome map
AA seq 532 aa AA seqDB search
MTQQTISRELVFTHALGDAEQQILTADAVNFLTVLVSRFTSQRNHLLAERREVQGRIDSG
ELPGFISEMDSIKNSDWKIRGIPSDLLDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWSKVIDGQINLRDAVRGTITYTSEAGKIYQLKPNPAVLICRVRGLHLPEKHVLWND
EPIPGSLFDFALYFFHNYRQLLAKGSGPYFYLPKTQSWQEAAWWGDVFSYTEDHFGLTRG
TIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQSV
TMDKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKEVERNAWVQEKVRQDKELEARNGH
DGTWIAHPGLADTVMPVFDRLLGERSNQLDVLREDDAPVTADELLAPCPGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHGKTLSDGRVVTKALFRQ
MLTEEMQVIRGELGDTRFDGGRFEEAARLMERITTQDALIDFLTLPGYDLLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacagacgataagcagggaactggtattcacccatgcattgggtgatgcagaa
cagcagattctgacggcggatgcggtgaattttcttacggtgctggttagccgctttaca
tcgcaacgcaatcacttgctggcggagcgccgggaggttcaaggccggatcgatagtggt
gagttaccgggttttatttcggaaatggattccataaaaaattcagactggaaaattcga
ggtattccatctgacttgctggatcgccgggtagagattaccggcccggtggaacgcaaa
atggtgattaatgccttgaatgccaatgtcaaagtctttatggcggactttgaagactcg
ctggcgcccagttggtcaaaggtgattgatgggcaaatcaacttgcgggatgccgtgcgc
ggcaccattacctataccagtgaggcgggaaagatttatcagctcaaacccaacccggcg
gtgttgatttgccgggtgcgcggcttgcacctgccggaaaaacacgtgctgtggaatgat
gagcctatccccggcagcctgtttgatttcgcactctatttttttcacaactaccgccaa
ttgctggcaaaaggcagcggcccgtatttttatttgccgaaaacccaatcctggcaggag
gccgcctggtggggtgacgtgttcagttataccgaagaccattttggcctgacgcgcggt
accatcaaagccaccgtgctgattgaaaccctgccggccgtgttccagatggacgaaatt
ctctatcacctgcgcgatcacatcgtcgggctgaattgtgggcgttgggattacatcttc
agttatatcaagacgttgaaaaatcatccggatcgggtattgccagaccggcagtcggta
accatggacaagccgttcctgagcgcttattcgcgtttgctgatcaaaacctgtcaccga
cgcggcgcgtttgcgatgggcggaatggccgccttcattcccagcaaagaggtggaacgc
aacgcctgggtgcaggagaaagtcaggcaggacaaggaactggaggcccgcaatggtcat
gacggcacttggatcgcccatcccggcctggctgatacggtgatgccggtgttcgatcgc
ctgctgggcgagcgttccaaccaactggatgtgttgcgcgaagacgatgcgccggtgacc
gccgacgaactgctggcaccttgtccgggagaacgtaccgaagccggtatgcgcgccaat
atccgcgtggcggtgcaatacatcgaagcctggatttccggcaatggctgcgtaccgatt
tacgggttgatggaagacgccgccaccgccgaaatctcccgcacctccatctggcagtgg
atccaccacggcaaaaccctcagcgatggccgcgtggtgaccaaagcgctgttccgccaa
atgctgaccgaagagatgcaggttatccgcggtgaactgggcgatacccgcttcgacggc
ggccgttttgaggaggcagcccgattgatggaacgcatcaccacgcaggacgcgttaatc
gattttctcaccttacccggttacgacttacttgattaa

DBGET integrated database retrieval system