KEGG   Dickeya zeae Ech1591: Dd1591_0366Help
Entry
Dd1591_0366       CDS       T00930                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
dze  Dickeya zeae Ech1591
Pathway
dze00630  Glyoxylate and dicarboxylate metabolism
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01120  Microbial metabolism in diverse environments
dze01200  Carbon metabolism
Module
dze_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Dd1591_0366
Enzymes [BR:dze01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Dd1591_0366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: ACT05256
JGI: Dd1591_0366
UniProt: C6CI10
Position
408632..409939
Genome map
AA seq 435 aa AA seqDB search
MSTSRTQQIEQLEQEWTTPRWEGITRPYHAEDVVNLRGSVNPACTLAQLGAEKLWKLLNG
KSRKGYVNCLGALTGGQALQQAKAGLEAVYLSGWQVAADANLAASMYPDQSLYPSNSVPA
VVQRINNTFRRADQIQWANGIGQDDPRYTDYFLPIVADAEAGFGGVLNAFELMKSMIEAG
AAAVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVLGVPTLLVARTDADAAD
LLTSDCDDYDRDFVTGERTVEGFYRTRAGVEQAISRGLAYAPYADLVWCETSTPDLALAR
RFAEAIHARFPGKLLAYNCSPSFNWKKNLDDHTIARFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFAAIEQGYTFSSHQQEVGTGYFDKVTTLIQGGA
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctctcgtacccaacaaatcgagcaactggaacaagagtggacaaccccgcgc
tgggaaggcatcacccgcccgtatcacgctgaggacgtagtcaatctgcgcgggtcggtg
aaccctgcctgcacactggcacaactgggggcggaaaagctgtggaagctgttgaatggt
aagtcgcgcaaaggttacgtcaactgccttggcgcactcaccggcgggcaggcgttgcag
caggcgaaagccgggctggaggcggtgtatttgtccggctggcaggtggcggcggacgcc
aacctggccgccagcatgtacccggaccagtcgctctatccgtctaactcggtgccggcg
gtggtgcagcgtatcaacaatactttccgacgagctgatcaaatccagtgggctaacggc
atcgggcaggatgacccgcgttataccgactactttttgccgattgtggcggatgccgaa
gccggttttggcggggtgttgaatgcgttcgagttgatgaaatcgatgattgaggcaggt
gccgccgccgtccattttgaagatcaactggcgtcggtgaagaagtgcgggcacatgggc
ggcaaagtgctggtgccgacgcaggaagcggtgcagaaactggtggcggcccggctggcg
gcggacgtgctgggcgtgccgacgttgctggtggcgcgtaccgacgccgacgccgccgat
ttactgacctcggattgtgatgattacgatcgggactttgttaccggtgaacgtacggtg
gaggggttttatcgcactcgcgccggggtggagcaggctatcagtcgcgggctggcctac
gccccttacgccgacctggtgtggtgtgaaacttcaacgccggatctggcgctggcacga
cgtttcgccgaggcgattcacgcccgtttccccggtaaattgctggcctataactgttcg
ccgtcgttcaactggaagaagaatctggatgatcacaccatcgctcgttttcaggatgaa
ctgtcggcaatgggctacaaataccagttcatcacgttggcgggtatccacagcatgtgg
tttaacatgttcgacctggcacatgcctatgcgcagggcgaaggcatgaagcactatgtg
gagaaagtgcagcagccggagtttgcggctattgagcaaggttacaccttctcctctcat
cagcaggaagtgggcaccggctatttcgacaaggtaacaaccctgattcagggcggcgcg
tcgtctgtgaccgcgttgaccggatcgaccgaagaacaacaattctga

DBGET integrated database retrieval system