KEGG   Dickeya zeae: Dd1591_0366Help
Entry
Dd1591_0366       CDS       T00930                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
dze  Dickeya zeae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:dze01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:dze00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
408632..409939
Genome map
AA seq 435 aa AA seqDB search
MSTSRTQQIEQLEQEWTTPRWEGITRPYHAEDVVNLRGSVNPACTLAQLGAEKLWKLLNG
KSRKGYVNCLGALTGGQALQQAKAGLEAVYLSGWQVAADANLAASMYPDQSLYPSNSVPA
VVQRINNTFRRADQIQWANGIGQDDPRYTDYFLPIVADAEAGFGGVLNAFELMKSMIEAG
AAAVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVLGVPTLLVARTDADAAD
LLTSDCDDYDRDFVTGERTVEGFYRTRAGVEQAISRGLAYAPYADLVWCETSTPDLALAR
RFAEAIHARFPGKLLAYNCSPSFNWKKNLDDHTIARFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFAAIEQGYTFSSHQQEVGTGYFDKVTTLIQGGA
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctctcgtacccaacaaatcgagcaactggaacaagagtggacaaccccgcgc
tgggaaggcatcacccgcccgtatcacgctgaggacgtagtcaatctgcgcgggtcggtg
aaccctgcctgcacactggcacaactgggggcggaaaagctgtggaagctgttgaatggt
aagtcgcgcaaaggttacgtcaactgccttggcgcactcaccggcgggcaggcgttgcag
caggcgaaagccgggctggaggcggtgtatttgtccggctggcaggtggcggcggacgcc
aacctggccgccagcatgtacccggaccagtcgctctatccgtctaactcggtgccggcg
gtggtgcagcgtatcaacaatactttccgacgagctgatcaaatccagtgggctaacggc
atcgggcaggatgacccgcgttataccgactactttttgccgattgtggcggatgccgaa
gccggttttggcggggtgttgaatgcgttcgagttgatgaaatcgatgattgaggcaggt
gccgccgccgtccattttgaagatcaactggcgtcggtgaagaagtgcgggcacatgggc
ggcaaagtgctggtgccgacgcaggaagcggtgcagaaactggtggcggcccggctggcg
gcggacgtgctgggcgtgccgacgttgctggtggcgcgtaccgacgccgacgccgccgat
ttactgacctcggattgtgatgattacgatcgggactttgttaccggtgaacgtacggtg
gaggggttttatcgcactcgcgccggggtggagcaggctatcagtcgcgggctggcctac
gccccttacgccgacctggtgtggtgtgaaacttcaacgccggatctggcgctggcacga
cgtttcgccgaggcgattcacgcccgtttccccggtaaattgctggcctataactgttcg
ccgtcgttcaactggaagaagaatctggatgatcacaccatcgctcgttttcaggatgaa
ctgtcggcaatgggctacaaataccagttcatcacgttggcgggtatccacagcatgtgg
tttaacatgttcgacctggcacatgcctatgcgcagggcgaaggcatgaagcactatgtg
gagaaagtgcagcagccggagtttgcggctattgagcaaggttacaccttctcctctcat
cagcaggaagtgggcaccggctatttcgacaaggtaacaaccctgattcagggcggcgcg
tcgtctgtgaccgcgttgaccggatcgaccgaagaacaacaattctga

DBGET integrated database retrieval system