KEGG   Dickeya zeae Ech1591: Dd1591_0635Help
Entry
Dd1591_0635       CDS       T00930                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dze  Dickeya zeae Ech1591
Pathway
dze00010  Glycolysis / Gluconeogenesis
dze00020  Citrate cycle (TCA cycle)
dze00620  Pyruvate metabolism
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01120  Microbial metabolism in diverse environments
dze01130  Biosynthesis of antibiotics
dze01200  Carbon metabolism
Module
dze_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd1591_0635
   00020 Citrate cycle (TCA cycle)
    Dd1591_0635
   00620 Pyruvate metabolism
    Dd1591_0635
Enzymes [BR:dze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dd1591_0635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H HlyD_D23 NQRA HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACT05517
JGI: Dd1591_0635
UniProt: C6CK00
Position
722490..724370
Genome map
AA seq 626 aa AA seqDB search
MAIEIKVPDIGADEVEVTEVLVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVA
VGDKVETGKLIMVFEAEGAAAAAPAPAAAPAPVAAPAAASAAKEVEVPDIGGDEVEVTEV
LVKVGDTVAAEQSLITVEGDKASMEVPAPFAGTVKEIRVKTGDKVKTGSLIMVFEVAGAA
PAAAPTPAASAPAAAPAVSGGAKDVNVPDIGGDEVEVTEVLVKVGDKVSAEQSIITVEGD
KASMEVPAPFAGTVKEIKVSTGSKVKTGSLIMVFEVEGAAPAAAPAPVAAAAAASAPAAA
SAPAVAKADGKSEFAENDAYIHATPVIRRLAREFGVNLAKVKGTGRKGRILREDVQAYVK
EAVKRAESAPAAGATGGSLPGLLPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWVMIP
HVTHFDKTDITDLEAFRKQQNVEAEKRKLDVKITPVVFIMKAVAAALEQMPRFNSSLSED
AQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTAGEMQ
GGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSFDHR
VIDGADGARFITIINNTLSDIRRLVM
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaggtaccggatatcggtgcagatgaagttgaagtcaccgaagtg
ctggttaaagtgggtgacaaagtggaagccgagcagtcgctgattactgtagaaggtgac
aaggcatccatggaagtcccctctccacaggcgggtgtggttaaagagattaaagtagcg
gtaggcgacaaggtcgagaccggcaaactgatcatggtcttcgaagcagaaggtgcggcg
gctgccgcaccggctccggctgctgcgccagcgcctgtcgcggcaccggccgctgccagc
gcggcgaaagaagttgaagtaccggatatcggcggcgacgaagtcgaagtgaccgaagta
ctggtgaaagtcggcgacaccgtggcggcagagcagtcgctgattacggtggaaggcgac
aaagcctcaatggaggtcccggcgccgttcgccggtacggtaaaagaaattcgcgtcaag
accggcgacaaggtgaaaaccggctcgcttatcatggtgtttgaggtggcgggtgcagca
cctgctgctgctccgacacctgccgccagtgcacctgccgccgcgccagcggtgagcggt
ggtgcgaaagacgtcaacgtgccggatatcggcggcgatgaagtcgaagtgaccgaagtg
ctggtgaaagtcggtgataaagtgtcggcggaacagtcgattatcaccgtggaaggcgac
aaagcgtcaatggaagtgccggcaccgttcgcgggtactgtgaaagaaatcaaggttagc
accggcagcaaggtgaaaaccgggtcgcttatcatggtgttcgaagtggaaggcgcggca
ccggctgcggctcctgcgccagttgcagccgctgcggctgccagcgcaccggcggctgca
tcagctccggctgtggcgaaagccgacggcaagagcgagttcgccgagaacgacgcttac
attcatgcgacaccggtgattcgtcgcctggcacgcgagttcggcgtcaatctggcgaaa
gtgaaaggtactggccgtaaaggtcgtatcctgcgcgaagacgtacaggcgtatgtgaaa
gaagccgtgaaacgcgccgaatctgctccggcggcgggtgcaaccggcggttctctgccg
ggtctgttgccgtggccgaaagtggatttcagcaagtttggtgaaattgaagaagtggag
ctgggtcgtatccagaaaatctctggtgctaacctgagccgtaactgggtgatgatcccg
catgttacgcacttcgataaaaccgatatcaccgatctggaagcgttccgcaaacagcag
aacgtggaagccgagaagcgtaaactggatgtgaagatcacgccggtcgtgttcatcatg
aaagcggttgccgctgcgcttgagcagatgcctcgcttcaacagttcgctgtctgaagac
gctcaacgcctgacgctgaagaaatacatcaacatcggtgttgcggtagatacgccgaat
ggtctggtggttccggtgttcaaagatgtgaataagaaaggcatcattgagctgtctcgt
gaactgatgaccatctctaagaaagcccgtgacggtaagctgaccgcaggcgaaatgcag
ggtgggtgctttaccatctccagcatcggtggtctcggtacgacgcatttcgcgccgatc
gtcaacgcgccggaagtggctattctgggtgtgtctaagtccgccatggaaccggtctgg
aatggtaaagagtttgttccgcgtctgatgatgccgatctctctgtccttcgaccaccgt
gtcattgacggtgctgatggtgcacgcttcattaccatcatcaacaacaccttgtccgac
attcgccgtctggtgatgtaa

DBGET integrated database retrieval system