KEGG   Dickeya zeae: Dd1591_0737Help
Entry
Dd1591_0737       CDS       T00930                                 

Definition
glycoside hydrolase family 1
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
dze  Dickeya zeae
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd1591_0737
Enzymes [BR:dze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Dd1591_0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
848699..850135
Genome map
AA seq 478 aa AA seqDB search
MSKVSMTLPEGFILGAASSAWQTEGWSGKKSGQDSYLDLWYKRDRQVWHNGYGPAVATDF
YNRYREDVALMKQTGLTHFRTSINWSRFMLDYENGVVDEEYAAYIDNLIDELHRQGIEPM
LCLEHYELPAVLFEKYQGWSSKQVVEWFVQYADAVFARYAGKVKRWFTFNEPIVVQTRVY
LDAVRYPYQQDSGVWMQWNHHKNLATAKVVQLFRDKGYHRDGGSIGVILNPEVTYPRSSA
AHDVEAARLYDLFYNRVFLDPALKGEYPAELLALLEKHQVHWDYTEEELAIIRANTVDEV
GINLYYPHRVKAPSRAWNSNTPFHPAYYYEHFELPGRRMNKSRGWEINPRIIYDMAMRLK
DEYGNVPWFVSENGMGIENEGQFKDSRGVIQDDYRIAFIAEHLYWTLKAREDGANCLGYM
LWAFTDNVSPMNAFKNRYGLIEIDLEHDRQRRAKKSAGWFSQVRDGGVLSFELDDEDK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggtatcaatgacccttcctgagggatttattctgggggcggcatcatccgcc
tggcagaccgaggggtggtcgggcaagaaaagcgggcaggattcctatctggacctgtgg
tacaaacgcgatcgtcaggtgtggcacaacggctatggcccggcggtcgccaccgatttc
tacaaccgctaccgtgaagacgtggcgttgatgaagcagaccgggctgacgcactttcgt
acctccatcaactggtcgcgcttcatgctggactatgaaaacggcgtggtggatgaagag
tacgccgcttacatcgacaatctgatcgacgaactgcaccggcaaggcatcgaaccgatg
ctgtgtctggaacactatgaattgccggcggtgctgttcgagaagtatcagggttggtcg
tcgaagcaggtggtggagtggttcgtgcagtatgccgacgcggtgttcgcccgctatgcc
ggcaaagtcaaacgctggttcacctttaacgagccgattgtggtgcagacccgcgtctat
ctggacgcggtgcgctacccttaccagcaggacagcggcgtctggatgcagtggaaccac
cacaagaatctggcgaccgccaaagtggtgcaactgttccgcgataaaggttaccaccgc
gacggcggcagcatcggggtgatcctcaacccggaagtcacctatccgcgttccagcgcg
gcacacgatgtggaggcggcgcgcctgtatgacctgttctacaaccgggtctttctcgac
ccggcgctgaaaggcgagtacccggcggagctgctggcgctgctggaaaagcaccaggtg
cattgggattacaccgaggaggagctggcgattatccgcgccaataccgtggacgaggtg
gggatcaatctctattacccgcaccgggtcaaagcgcccagccgggcgtggaacagcaat
acgccgttccacccggcttactattacgagcatttcgagctgcctggccgccggatgaac
aagtcgcgcggttgggaaatcaacccccgcattatttacgacatggcgatgcgcctgaag
gatgagtacggcaacgtgccctggttcgtgtcggaaaacggcatggggattgaaaacgaa
ggccagttcaaagacagccgcggcgtgatacaggatgactaccgcatcgcgtttatcgcc
gagcacctttactggacgctgaaggcgcgtgaagacggggccaactgtctgggttacatg
ctgtgggcgtttaccgacaacgtctcgccgatgaacgcgttcaaaaaccgttacggcctg
attgaaatcgatctggaacacgaccggcagcgtagagcgaagaaatcggccggctggttc
agtcaggtacgggacggcggcgtgctgtcgttcgaactggacgatgaagataaatag

DBGET integrated database retrieval system