KEGG   Dickeya zeae: Dd1591_0784Help
Entry
Dd1591_0784       CDS       T00930                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dze  Dickeya zeae
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dd1591_0784
Enzymes [BR:dze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dd1591_0784
Transfer RNA biogenesis [BR:dze03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Dd1591_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
899720..900460
Genome map
AA seq 246 aa AA seqDB search
MLEQICQLAREAGDAIMQVYNGQQPLNVAHKKDDSPVTAADLAAHQVIARGLATLSPEIP
MLSEEDPQAWSERRHWQRYWLVDPLDGTKEFLNRNGEFTVNIALIDNGQPVLGVVYVPVT
GVMYAAAEGKAWKEENGTRRAIRVKDARPPLVVVSRSHADAELEDYLRQLGEHQTVSIGS
SLKFCLVAEGKAQLYPRFGPTNVWDTAAGHAVALAAGAQVHDWQGRALSYAPRESFLNPG
FRVSIF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacagatctgccagttggcgcgtgaagcgggagacgccatcatgcaggtatat
aacggccagcaaccgctgaatgtggcgcataaaaaagacgactcaccggtgacggcggcc
gatttggcggcacaccaggtgattgcgcgtgggttggctacgctgtcccccgagattccg
atgctgtcggaagaggatccgcaggcgtggtctgaacgtcggcattggcagcgttactgg
ctggtcgatccgctggacggcacgaaagagtttcttaaccgcaacggcgaatttaccgtc
aatatcgcgttgattgataacggtcagccggtattaggggtggtgtatgtgccggtgacc
ggcgtgatgtacgccgcggcagagggcaaagcctggaaagaagagaacggcacacggcgc
gcgattcgggtgaaagacgccaggccgccgctggtggtagtgagccgctcccatgcggat
gccgaactggaagactatttacgtcagttaggcgaacaccagaccgtgtccatcggttcg
tcgctgaaattctgtctggtggcggaaggtaaggcccagctttacccgcgcttcgggccg
acgaacgtctgggataccgcggccgggcacgccgtggcgctggctgccggtgcacaggtg
catgactggcaagggcgtgcgctgtcttatgcgccgcgtgagtccttcctgaatccgggg
ttccgggtgtcgatcttctga

DBGET integrated database retrieval system