KEGG   Dickeya chrysanthemi: Dd1591_0839Help
Entry
Dd1591_0839       CDS       T00930                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dze  Dickeya chrysanthemi
Brite
Enzymes [BR:dze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dd1591_0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 RrnaAD Methyltransf_25 Methyltransf_11 Methyltransf_23 DREV NodS GCD14 Trigger_C CMAS
Motif
Other DBs
NCBI-ProteinID: ACT05718
JGI: Dd1591_0839
UniProt: C6CLT3
Position
972479..973105
Genome map
AA seq 208 aa AA seqDB search
MVNKRVQTLLTQLRQQGIQDERLLQAMASVPRERFVDEAFEHKAYDNVALPIGSGQTISQ
PYTVARMTELLRLTTESRVLEIGTGSGYQTAILAHLVRHVFSVERIKGLQWQAKRRLKQL
DLHNVSTRHGDGWQGWSSKGPFDAIIVTAAPPEIPSALMAQLDEGGIMVLPVGEQQQTLQ
VVVHRNSEFIIQTVETVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacaaacgcgtacaaacactgctgacacagcttcgccagcagggtattcaggat
gaacgtctgttgcaggcgatggcttcggttcctcgtgagcgttttgttgacgaggctttc
gagcataaagcctatgataatgtcgcgttgccgattggctccggacaaaccatttcccaa
ccttataccgttgccagaatgaccgaattactgcggctgacgacagaatcccgcgtgctg
gaaatcggcaccggttccggttatcagaccgcgatactggcgcatctggtgaggcatgtc
ttttcggttgagcgcattaagggcctgcaatggcaggctaaacggcgtctcaagcagttg
gatctgcacaatgtctccactcgccatggcgacggctggcaaggctggtcgtctaaaggt
ccgttcgatgcgatcattgtcaccgccgcaccgcctgagatcccctcagccctgatggcg
caactggatgagggcggcattatggtgttgccggtgggcgagcagcagcaaacattgcag
gtggttgtgcaccgcaatagcgaatttattatccagacagtagaaacggttcggtttgtt
ccgctggtcaaaggggaattggcttga

DBGET integrated database retrieval system