KEGG   Dickeya zeae: Dd1591_1029Help
Entry
Dd1591_1029       CDS       T00930                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dze  Dickeya zeae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dd1591_1029
Enzymes [BR:dze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Dd1591_1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1184210..1184698)
Genome map
AA seq 162 aa AA seqDB search
MICVYLALGSNLSEPLQQVRAALNALDAIENTRLVRCSSFYRSRPLGPQDQPDYLNAVAK
LQTGLSPEALLDNTQRIELEQGRVRKENRWGPRTLDLDILLFGDMTLHTERLTVPHYDMK
NREFMLYPLAELAMELVFPDGEALATRLQQVPRNGLTRWDER
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgatctgcgtgtacctggccttgggcagtaatctgtccgagccattgcagcaggtacgc
gcagcgcttaacgcgctggatgcgattgaaaatacccggctggtgcgctgctcgtctttc
tatcgcagccgcccgcttggcccgcaggatcagcctgattatctcaacgccgtcgccaaa
ttacagaccgggttatcacccgaagcgttgttggacaacacccaacgcattgagttggaa
caagggcgggtgcgcaaagaaaaccgctggggaccacgtaccctcgacctggatatcctg
ttgtttggcgacatgacgctgcataccgagcggctcaccgtgccgcactacgacatgaaa
aaccgcgagtttatgctctacccgctggcggagctggcgatggagctggtgtttcctgat
ggagaagcgctggcgacgcggttacaacaggtgccacgcaacggcctgacacggtgggac
gagcgataa

DBGET integrated database retrieval system