KEGG   Dickeya zeae: Dd1591_1280Help
Entry
Dd1591_1280       CDS       T00930                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
dze  Dickeya zeae
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dd1591_1280
Enzymes [BR:dze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dd1591_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1451151..1453208
Genome map
AA seq 685 aa AA seqDB search
MKRFSPLNPKVEGLLHGADYNPEQWENYPGIIDDDIAMMKQVKCNVMSVGIFSWAKLEPQ
EGVYRFDWLDEVIDKLYQQGISVFLATPSGARPAWMSQRYPDVLRVGRDRVAALHGGRHN
HCLSSPVYRDKVQKINTLLAERYGHHPAVIGWHVSNEYSGECHCERCQQAFRTWLKARYQ
TLDNLNHAWWSDFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFNTAQATDFCAQEIAP
LKRVNPAIPATTNFMEYFYDYDYWQLSQVLDFISWDSYPMWHRDKDDATLACYIALFHDL
MRSLKQGKPFVLMESTPSVTNWQPLSKLKKPGMHILSSLQAVAHGADAVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRVGREVAQLGQILSQLSAVAGSRVEAQVAILFDWESRWAMDDA
QGPRNAGLEYEKTVAEHYRPFWEQGVAVDVINADGDFSGYRLLVAPMLYMVRPGFAERVE
QFVRQGGQVVVTYWSGIVNDSDLCYQGGFPGPLRPLLGIWSEEIDCLADGEYNRVLGLAD
NDIGLKGPYQARHLCELIHLEGATALASYCDDFYAGRPAVTVNRVGDGKAWYVTSRNDLA
FQRDFFAAIISELALPRALDIPLPPAVTAHRRTNGDEEFIFIENYSAVPQPIRLPAGYSD
MLTGLPLADVVLSAWDCRVIRRRLV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgattttcgccgttgaatccgaaggtcgaaggattattacatggcgctgattat
aatccggagcaatgggagaattaccccggcattattgatgacgatatcgccatgatgaaa
caggtgaaatgtaatgtcatgtcagtggggattttcagttgggctaaactggagccgcag
gaaggggtatatcggttcgactggctggatgaggtgattgataaattatatcagcagggg
atttcggtgtttctggcgacgcccagcggcgcgcgtccggcctggatgtcgcaacgttat
ccggacgtgctgcgcgttgggcgcgaccgggtggcggcgctgcacggcggccgccataat
cactgcctgtcatcgccggtctaccgggataaggttcaaaagatcaatacgttgttggct
gagcgctacgggcaccacccggcggtcatcggctggcatgtttccaatgaatacagcggc
gagtgccattgcgagcgctgtcagcaggcgttccgcacctggcttaaagcgcgttaccag
acgctggataacctcaatcacgcctggtggagcgatttctggagccacacctacagcgac
tggtcgcagattgaatcgccggcgccgcagggtgaagtatccattcatgggctgaatctt
gactggcggcgctttaataccgcacaggcaaccgacttctgcgcacaggaaatcgcgccg
ttgaagcgggtaaacccggccattccggcaaccaccaacttcatggagtatttctacgat
tacgattactggcaactgtcgcaggttctggattttatttcctgggacagctacccgatg
tggcatcgcgacaaggacgacgccacgctagcctgttatatcgccctgttccatgacctg
atgcgctcgcttaagcagggcaagccgtttgtgttgatggaatccactcccagcgtcacc
aactggcagccgctcagcaagctcaaaaaaccgggtatgcatattctctcctcgctacag
gcggtggcgcacggtgcggatgcggtgcagtatttccagtggcgtaagagtcgcggttcg
gtggagaaattccacggcgcggtggtggatcatgtcggccacatcgacacccgagtcggc
cgggaggtggcgcagctcggccagatattgtcgcaactgagtgcggtggcgggcagccgg
gtggaagcgcaggtggctatcttgtttgactgggaaagccgctgggcgatggatgatgcg
caagggccgcgcaatgccgggctggagtacgaaaaaacggtggcggagcattatcgcccg
ttctgggagcagggagttgcggttgatgttatcaacgccgatggtgatttcagcggttat
cggttgctggttgcgccgatgctgtacatggtacggccaggctttgccgaacgcgtcgaa
cagtttgtgcggcagggtgggcaggtggtggtgacctactggagcggcatcgttaacgat
agcgatctgtgttatcagggcggatttcccggcccgttgcgcccactgttggggatctgg
tcggaagagatagactgtctggccgacggcgaatataaccgagtgctggggctggcggac
aatgacatcgggcttaaggggccgtatcaggcgcgtcatctgtgcgagttgatccacctt
gaaggcgcaacggcactcgccagttactgcgatgatttttacgccggccggccggcggta
acggtgaatcgcgtcggcgacggaaaagcctggtacgtgacctcgcgtaacgacctggca
ttccagcgcgatttctttgccgccatcatcagcgagctggctttgccgcgagcgctggat
atcccgctgccgccggcggtgacggcccatcgccgtaccaacggcgacgaagagtttatc
ttcatcgaaaactacagtgcggtgccgcaacccattcggttgcctgccgggtatagcgat
atgctgaccgggttaccgctggcggatgtcgtgctttccgcctgggattgccgggtaatt
cgtcgccgtctggtctga

DBGET integrated database retrieval system