KEGG   Dickeya zeae: Dd1591_1637Help
Entry
Dd1591_1637       CDS       T00930                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dze  Dickeya zeae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dze00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:dze00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1860884..1861981
Genome map
AA seq 365 aa AA seqDB search
MVPPGRPCKRFDNQSDVQLTKEVFVGPLMLDVAGYELDAEDREVLAHPLVGGVILFSRNF
HDADQLAELVRQLRRASRERLVVAVDQEGGRVQRFRNGFTALPAAQSFAALNPLALAQQL
AEEAGWVMAAEMTALDIDISFAPVLDVGHQSAAIGDRAFHDDPDTLLAVAERFITGMRTA
GMKATGKHFPGHGAVTADSHKETPRDERSLAQIRERDMWVFRELIARQRLDAVMPAHVIY
SDADPRPASGSPYWLRQVLRQELGFGGIIFSDDLSMEGAAVMGGYAERAQAALDAGCDMI
LVCNQRQGAISVLDNLSPVKVPGLETLYHRGVITRRELLNSPRWKQATSQLTALSERWQA
HKAAG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgccgggacggccgtgtaagcggtttgacaaccagagcgatgtgcaattaaca
aaagaggtttttgtgggtccgttaatgttagatgtggctggctatgagctggacgcggaa
gatcgcgaggtgctggcgcacccgctggtaggcggcgtgatcctgttcagccgtaatttt
cacgatgccgaccaactggcggaattggtgcgtcaactacgtcgtgcctcgcgtgaacgg
ctggtggtggcggtcgatcaggaaggtggccgggtacagcggttccgtaacggttttacc
gcactgccggctgcgcagtcgtttgctgcgttgaacccgctggcgctggcgcagcaactg
gctgaagaagccggctgggtaatggcggcggagatgactgccctggatattgatatcagt
tttgcaccggtgctggatgtgggccaccagagcgccgcaatcggcgatcgtgctttccac
gacgacccggataccttgctggccgtggcggaacgttttatcaccggtatgcgcacggca
gggatgaaggcgacgggcaagcatttccccggacacggtgcggtaacggcggattcccat
aaggaaactccgcgagacgaacgctcgctggcgcagattcgtgagcgggatatgtgggtc
ttccgggagttgattgcccggcaacggttagatgccgttatgccggcgcatgtgatttat
agcgatgccgatcctcgtccggccagtgggtcgccgtactggctgcggcaggtactgcgt
caggaactgggattcggcggtatcatcttctcggatgacctgtcgatggagggggccgcg
gtgatgggcggttatgccgagcgcgcccaggcggcgctggatgccggctgcgatatgatt
ctggtctgcaatcagcggcagggggcaatcagcgtattggataatctgtctccggtcaaa
gtaccgggtctggagacgctttatcatcggggcgtgatcacgcgtcgggaactgctgaat
tcgccgcgctggaagcaggcgacgtcgcagttgacggcactgagtgagcgctggcaggca
cataaagccgccggttga

DBGET integrated database retrieval system