KEGG   Dickeya zeae: Dd1591_1655Help
Entry
Dd1591_1655       CDS       T00930                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dze  Dickeya zeae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dze00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dze00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1885178..1885729
Genome map
AA seq 183 aa AA seqDB search
MSNDIYAIPLQTIDGRQTTLENWRNNVLLVVNVASQCGLTRQYEALENLYETYRDRGFAV
LGFPSNEFAGQEPGSNEEISAFCRGTFGVQFPMFGKIAVNGSERHPLYQALTQAQPQALR
PQGSEFYERRVSKGQAPVHPGDILWNFEKFLINRRGEVIARFSPDMTPDDSVIIKAVEQA
LAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgacatctacgcaattcccctgcaaaccatcgatggccgtcagacaacactg
gaaaactggcgtaataacgtgctgctggtagtgaatgtcgcttcgcagtgtgggctgacc
cggcaatatgaagccctggaaaatctgtacgaaacgtatcgtgatcgcgggtttgccgta
ttgggttttccttccaatgaatttgccgggcaggagccgggcagcaacgaggagataagc
gcgttttgccgcgggactttcggcgtacagtttccgatgtttggcaaaatagcggtcaac
ggcagtgagcgccacccgttgtatcaggcattgactcaggcacaaccgcaagcgttacgg
ccgcagggcagtgaattttacgagcgccgcgtcagcaaaggccaggcgcccgtacatcct
ggcgatattctgtggaattttgaaaaatttttgattaatcgccgtggtgaggtgatagca
cgcttttcacctgatatgacgccggatgacagcgtgattatcaaagccgttgaacaggcg
ctggcgcagtaa

DBGET integrated database retrieval system