KEGG   Dickeya zeae: Dd1591_2026Help
Entry
Dd1591_2026       CDS       T00930                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dze  Dickeya zeae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dze03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2327792..2329837
Genome map
AA seq 681 aa AA seqDB search
MNMTRHDELTRLLDQWVDCGWLRELDRALVRFLHQECPEASPLLLLGAALVSYQLGRGHV
CLDLAATLADSGFSLALPPEGDRSENSKIARPAEVLAGVTLAAWQAALQQPPLVSSGEGN
TPLVLVGSRLYLRRYWQYEQDVRHAVMQRLQQNAALRAAIAPAALRRRLEALFPAAGSNA
TDWQKLACALAAGSAFSIITGGPGTGKTTTVVKLLALLQSLALEQQGKPLRIRLAAPTGK
AAARLNESIAGAIAGLSLDGLAQGDAIRTHINSEVVTLHRLLGSRPDSRHFRHHADNPLL
LDVLVVDEASMVDLEMMAALLAAMPARSRLVLLGDKDQLASVEAGALMGELCQRAAQGHY
LPLTGDWLREVAGDAPADDLLDPYGTALDQSIVMLRHSYRFGADSGIGKLADAVNAGDSA
ALASVWRRGFADLAQLTLSANDDKTLREWVIDGAAGRFGTQVGAAAPVGYGDYLRRMVAT
QPDLTAPQSEFDHWASQILAAFGRFQLLCALRNGPWGVDNMNTRIAHLLHRNGLLAAWQG
WYPGRPVMVTRNDYGQRLMNGDIGITLAVPQRQPDGALSWVSRVAFPAGDGTSGIRWVMP
GRLSAVETVFAMTVHKSQGSEFAHTALLLPDTLSPILTRELIYTGITRAKHAFSLGCAGE
HSTVLAEAVSRRVLRVSGLSG
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgacccgtcatgacgaattaacccggttgctggaccaatgggttgactgcggc
tggctgcgagagttggatcgggcgctggtgcgctttctgcatcaggagtgcccggaggcg
tcgcctttattgttgctgggtgcggcgctggtcagttatcagcttggacgcggacatgtg
tgcctcgatctggccgctacgctggccgacagcggattctcgctggcgttgccgccggaa
ggcgatcgcagcgaaaacagcaaaatagcgcgcccggcggaggtgctggccggtgtgacc
ctggcggcttggcaggcggcgctgcaacagccgccgctggtatcgtcgggggaaggtaat
acgccgctggtgctggtaggctcgcgtctttatctgcgtcgctactggcagtatgagcag
gatgtgcgtcacgccgttatgcaacggttgcagcaaaatgcggcgttacgcgcggccatt
gcgcccgcggcgctgcgccgacggctggaggcgctgtttcctgccgccgggagtaacgcg
accgattggcagaaactggcctgtgcactggcggcgggcagtgcgttcagcatcattacc
ggcgggccgggcaccgggaaaaccaccaccgtggtaaaactgctggcgctgttgcaatcg
ttggcgctggagcagcagggcaaaccgctgcgtatccggctggcggcgcccaccggcaag
gcggcggcgcggctgaacgagtccatcgccggggcgattgccggtttgtcgctggacggg
ctggcgcaaggcgatgctattcgtacgcacattaacagtgaggtggtgacgctgcaccgt
ttactcgggagccgcccggacagccgacatttccgtcatcacgccgataacccgctgctg
ctggacgtgctggtggtggatgaagcctcgatggtggatttggagatgatggcggcgctg
ctggccgcgatgccggcgcgttcccgactggtactgctgggcgataaagaccaactggca
tcggttgaagcgggggcgttgatgggtgagctgtgccagcgcgccgcacaagggcactac
ctgccgctgaccggtgactggctgcgcgaggtagcgggagacgcgccggccgatgactta
ctcgatccatacggcaccgcgctggatcaatcgattgttatgttgcgccacagctaccgt
tttggcgcggacagcggcatcggcaaactggctgacgcggtgaatgccggcgatagcgcg
gcactggcgtctgtctggcggcgcgggtttgccgatttggcgcaattaaccctgagcgcg
aacgatgacaagacgttgcgcgaatgggtgatagacggtgccgccggccgcttcggcacg
caggtcggtgcggcggcaccggtaggctacggcgactacctgcgccggatggtggcgacg
caaccggatttgacggcgccgcaaagcgagtttgatcactgggcatcgcagattctggcg
gcgttcggccgcttccaactgctgtgcgccttgcgcaacggcccctggggggtcgataac
atgaatacgcgcattgcccatctgttgcatcgcaatgggttgctggcggcctggcaaggc
tggtatccggggcgaccggtgatggtgacccgcaacgattacggccaacggctgatgaac
ggcgatatcgggattacgctggcggtgccgcagcgccagccggacggcgcactcagttgg
gtgagccgggtggcgtttcccgcaggggatggtacatccggtattcgctgggttatgccg
gggcgcttatcggcggtggaaacggtgttcgccatgacggtgcataaatcgcaggggtcg
gaattcgcccatacggcgttgctgctgccggataccttaagcccgatcctgacgcgtgag
ctgatctataccggcatcacccgcgctaaacacgccttcagcctcggttgcgccggagag
cacagtacggtgttggctgaggccgtcagccgacgggtattacgggtgagcggattgtca
gggtaa

DBGET integrated database retrieval system