KEGG   Dickeya chrysanthemi: Dd1591_2026Help
Entry
Dd1591_2026       CDS       T00930                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dze  Dickeya chrysanthemi
Pathway
dze03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dze00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dd1591_2026
Enzymes [BR:dze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Dd1591_2026
DNA repair and recombination proteins [BR:dze03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Dd1591_2026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Helicase_RecD Viral_helicase1 AAA_22 PhoH UvrD-helicase NTPase_1 DUF2075 AAA_28 UvrD_C T2SSE Mg_chelatase IPPT FtsK_SpoIIIE CbiA AAA_16
Motif
Other DBs
NCBI-ProteinID: ACT06872
JGI: Dd1591_2026
UniProt: C6CHH1
Position
2327792..2329837
Genome map
AA seq 681 aa AA seqDB search
MNMTRHDELTRLLDQWVDCGWLRELDRALVRFLHQECPEASPLLLLGAALVSYQLGRGHV
CLDLAATLADSGFSLALPPEGDRSENSKIARPAEVLAGVTLAAWQAALQQPPLVSSGEGN
TPLVLVGSRLYLRRYWQYEQDVRHAVMQRLQQNAALRAAIAPAALRRRLEALFPAAGSNA
TDWQKLACALAAGSAFSIITGGPGTGKTTTVVKLLALLQSLALEQQGKPLRIRLAAPTGK
AAARLNESIAGAIAGLSLDGLAQGDAIRTHINSEVVTLHRLLGSRPDSRHFRHHADNPLL
LDVLVVDEASMVDLEMMAALLAAMPARSRLVLLGDKDQLASVEAGALMGELCQRAAQGHY
LPLTGDWLREVAGDAPADDLLDPYGTALDQSIVMLRHSYRFGADSGIGKLADAVNAGDSA
ALASVWRRGFADLAQLTLSANDDKTLREWVIDGAAGRFGTQVGAAAPVGYGDYLRRMVAT
QPDLTAPQSEFDHWASQILAAFGRFQLLCALRNGPWGVDNMNTRIAHLLHRNGLLAAWQG
WYPGRPVMVTRNDYGQRLMNGDIGITLAVPQRQPDGALSWVSRVAFPAGDGTSGIRWVMP
GRLSAVETVFAMTVHKSQGSEFAHTALLLPDTLSPILTRELIYTGITRAKHAFSLGCAGE
HSTVLAEAVSRRVLRVSGLSG
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgacccgtcatgacgaattaacccggttgctggaccaatgggttgactgcggc
tggctgcgagagttggatcgggcgctggtgcgctttctgcatcaggagtgcccggaggcg
tcgcctttattgttgctgggtgcggcgctggtcagttatcagcttggacgcggacatgtg
tgcctcgatctggccgctacgctggccgacagcggattctcgctggcgttgccgccggaa
ggcgatcgcagcgaaaacagcaaaatagcgcgcccggcggaggtgctggccggtgtgacc
ctggcggcttggcaggcggcgctgcaacagccgccgctggtatcgtcgggggaaggtaat
acgccgctggtgctggtaggctcgcgtctttatctgcgtcgctactggcagtatgagcag
gatgtgcgtcacgccgttatgcaacggttgcagcaaaatgcggcgttacgcgcggccatt
gcgcccgcggcgctgcgccgacggctggaggcgctgtttcctgccgccgggagtaacgcg
accgattggcagaaactggcctgtgcactggcggcgggcagtgcgttcagcatcattacc
ggcgggccgggcaccgggaaaaccaccaccgtggtaaaactgctggcgctgttgcaatcg
ttggcgctggagcagcagggcaaaccgctgcgtatccggctggcggcgcccaccggcaag
gcggcggcgcggctgaacgagtccatcgccggggcgattgccggtttgtcgctggacggg
ctggcgcaaggcgatgctattcgtacgcacattaacagtgaggtggtgacgctgcaccgt
ttactcgggagccgcccggacagccgacatttccgtcatcacgccgataacccgctgctg
ctggacgtgctggtggtggatgaagcctcgatggtggatttggagatgatggcggcgctg
ctggccgcgatgccggcgcgttcccgactggtactgctgggcgataaagaccaactggca
tcggttgaagcgggggcgttgatgggtgagctgtgccagcgcgccgcacaagggcactac
ctgccgctgaccggtgactggctgcgcgaggtagcgggagacgcgccggccgatgactta
ctcgatccatacggcaccgcgctggatcaatcgattgttatgttgcgccacagctaccgt
tttggcgcggacagcggcatcggcaaactggctgacgcggtgaatgccggcgatagcgcg
gcactggcgtctgtctggcggcgcgggtttgccgatttggcgcaattaaccctgagcgcg
aacgatgacaagacgttgcgcgaatgggtgatagacggtgccgccggccgcttcggcacg
caggtcggtgcggcggcaccggtaggctacggcgactacctgcgccggatggtggcgacg
caaccggatttgacggcgccgcaaagcgagtttgatcactgggcatcgcagattctggcg
gcgttcggccgcttccaactgctgtgcgccttgcgcaacggcccctggggggtcgataac
atgaatacgcgcattgcccatctgttgcatcgcaatgggttgctggcggcctggcaaggc
tggtatccggggcgaccggtgatggtgacccgcaacgattacggccaacggctgatgaac
ggcgatatcgggattacgctggcggtgccgcagcgccagccggacggcgcactcagttgg
gtgagccgggtggcgtttcccgcaggggatggtacatccggtattcgctgggttatgccg
gggcgcttatcggcggtggaaacggtgttcgccatgacggtgcataaatcgcaggggtcg
gaattcgcccatacggcgttgctgctgccggataccttaagcccgatcctgacgcgtgag
ctgatctataccggcatcacccgcgctaaacacgccttcagcctcggttgcgccggagag
cacagtacggtgttggctgaggccgtcagccgacgggtattacgggtgagcggattgtca
gggtaa

DBGET integrated database retrieval system