KEGG   Dickeya chrysanthemi: Dd1591_2069Help
Entry
Dd1591_2069       CDS       T00930                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00900  Terpenoid backbone biosynthesis
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dd1591_2069
Enzymes [BR:dze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Dd1591_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACT06915
JGI: Dd1591_2069
UniProt: C6CHL4
Position
complement(2380214..2381086)
Genome map
AA seq 290 aa AA seqDB search
MATARNRWPSPAKLNLFLYITGRRPDGYHNLQTLFQFLDYGDTLTITPRQDQRIVLLTPL
PGVPDEQNLAIRAARLLQAWCRESGLPFAGADIGIDKRLPMGGGLGGGSSNAATVLVALN
QLWRSQVPVDALAALGLKLGADVPVFVRGHAAFAEGVGERLTPVSPPEKWYLVVHPGVSI
PTPLIFADPDLTRDTPARPLSQLLTQTFSNDCEAVARKRFREVEERLLWLLEYAPSRLTG
TGACVFAEFDTESAARQVLDRAPEGLQGFVARGVNVSPLQQRLSGQFKGC
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgcacgcaaccgctggccttccccggccaagctgaacctgtttttgtatatc
accggtcgccggccagacggttaccataacctgcaaacgttgtttcagttcctggattat
ggcgacaccctgaccatcacgccgcgccaggatcaacggatcgtcctgctgacacccttg
cccggcgttcccgatgagcaaaacctggccattcgcgccgcccgtctgttgcaggcgtgg
tgtcgcgaatccgggctgccgttcgccggcgccgacatcggcatcgacaaacgcctaccg
atgggcggtggtctgggcggcggttcgtccaacgccgccaccgtgctggtggcgctaaac
cagttgtggcgcagccaggtccccgtcgacgctctggccgcactgggcctcaagctgggc
gcggatgtgccggtgtttgtgcggggtcacgcggcgttcgccgaaggcgtaggagagcgg
ttaacgccggtctcgccgccggaaaaatggtatctggtggtgcatcccggcgtcagcatt
cccaccccgcttatctttgccgatccggatttgacgcgcgacacaccggcacgcccactg
tcacaattactgacacaaactttcagcaacgattgtgaagccgtcgcaagaaaacgtttt
cgtgaggttgaagagcgacttttatggctgttagaatacgcaccgtcgcgcctgaccggc
accggcgcttgcgtgtttgccgaattcgacaccgagtccgccgctcgtcaggtgttagac
cgggccccggaaggcttacagggttttgttgcgcgtggagtgaacgtgtctccgttgcaa
caacggctttccgggcaatttaagggttgctaa

DBGET integrated database retrieval system