KEGG   Dickeya zeae Ech1591: Dd1591_2176Help
Entry
Dd1591_2176       CDS       T00930                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dze  Dickeya zeae Ech1591
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dd1591_2176
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dd1591_2176
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dd1591_2176
Enzymes [BR:dze01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dd1591_2176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2503550..2504740
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGEFGGQYVPQILMPALRQLEEAFVDAQRDPAFQSEFSDLLKNYAGRPTALTR
CKNLTAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGSY
ETAHYLLGTAAGPHPYPTIVREFQRMIGEETKIQVKENEGRLPDAVLACVGGGSNAIGMF
ADFIDEPSVRLIGVEPAGLGIETGHHGAPLKHGRVGIYFGMKSPMMQTDDGQIEESYSIS
AGLDFPSVGPQHAHLSSIGRADYVSITDDEALNAFKELSRHEGIIPALESSHALAHALKM
IKAEPEKEQILVVNLSGRGDKDIFTVHDILKSRGDI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgttactaaacccttattttggtgaattcggtggtcagtatgtaccacagatcctg
atgccggcactgcgccagttggaagaggcatttgtcgacgcgcagcgcgacccggctttt
cagtctgaattcagcgatttactgaaaaactatgccggccgcccaaccgcactgacacgg
tgtaaaaacctgacggcaggcacccgaaccacgctctatctgaaacgcgaagacttgctg
cacggtggcgctcacaagactaaccaggtgttggggcaagccttgctggcaaaacggatg
ggaaaaacggaaatcatcgccgaaaccggcgccggccagcatggcgtcgccacggcgttg
gcctgtgcgctgttaggattgaagtgccgcgtttacatgggtgccaaggacgttgagcgt
cagtcgccgaacgtgtttcgtatgcggctgatgggagcggaagtcattccggtacacagt
ggttcctccaccctgaaagacgcctgcaacgaagcgttgcgcgactggtcgggtagctat
gaaaccgcccattatctgcttggcaccgccgccggcccccacccttaccccaccatcgtg
cgggagtttcagcgcatgataggggaagaaaccaaaattcaggtgaaagaaaacgaaggg
cgtctgcccgatgccgtgctggcctgcgttggcggcggctccaatgctatcggtatgttc
gccgacttcattgatgaaccatccgttcggttgattggcgttgagccggcgggtctgggt
atcgaaaccgggcatcacggtgcaccactgaaacatggtcgcgtcggtatctacttcggt
atgaaatccccgatgatgcaaaccgacgacggccagatagaagagtcatactctatttca
gccggtctggattttccctcggtcgggccgcagcacgcgcacctgagcagcatcggacgt
gcagattatgtctcgatcaccgatgatgaagcgctgaatgcgtttaaggaattgtcgcgt
catgaaggcatcatcccggcgctggagtcatcacacgcgttggctcatgcgctgaaaatg
atcaaagcagaaccggagaaagagcaaattctggtggttaatctatccggtcgcggcgat
aaagacatttttacggttcacgacattctgaaatcccggggagacatctga

DBGET integrated database retrieval system