KEGG   Dickeya zeae Ech1591: Dd1591_2177Help
Entry
Dd1591_2177       CDS       T00930                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dze  Dickeya zeae Ech1591
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dd1591_2177
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dd1591_2177
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dd1591_2177
Enzymes [BR:dze01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dd1591_2177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2504740..2505549
Genome map
AA seq 269 aa AA seqDB search
MERYHALFKRLSEKQEGAFVPFVTLGDPSPALSLHIIDALVAAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLATIRQKYPDLPIGLLMYANLVFSNGIDAFYQRCAQ
TGVDSVLVADVPVEESAPFRTAAMKHGIAPIFICPPNADDDLLREVASFGRGYTYLLSRA
GVTGAETRAQLPLHHLLEKLQEYHAAPPLLGFGISEPTQVQQALKSGAAGAISGSAIVKI
IEHHHAQPEVMLAKLTEFVSTMKAATRTH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctaccacgctttgtttaaacgactatcggaaaaacaggaaggggcgttcgta
ccgttcgtcacgctgggtgacccttcgcctgcgctttcactgcacattattgatgcactg
gtcgccgcaggggccgacgcactggagttgggtattcccttctccgatccgctggccgac
ggcccaaccattcaaaatgctacgctgcgggcgttcgccgcgggcgtcaccccggcgcaa
tgttttgaaatgttggcgactatccgccagaaataccctgatctgccgataggcttgctg
atgtacgccaatctggtgttcagcaatggtatcgacgctttttatcagcgttgtgcgcaa
accggtgttgactcggtgctggtggccgacgtgccggtggaagaatccgcgccgtttcgc
actgcggcaatgaagcatggcattgcgcccatctttatttgcccgccgaatgccgatgat
gatctgctgcgtgaagtcgcttctttcggccgcggttacacctacctgctctcgcgggct
ggtgtgaccggtgcggaaacccgcgcccagttgccgttacatcacctgctggaaaaactg
caggaataccacgcggctccgccactgcttggtttcggcatttccgagccgacgcaggtg
cagcaggcgttgaaatccggtgccgccggggcgatttccggttcggctattgtcaaaatc
attgagcaccaccatgcccagccggaggtgatgctggccaaactgaccgagtttgtcagt
accatgaaagccgcgacccgcacacactga

DBGET integrated database retrieval system