KEGG   Dickeya zeae: Dd1591_2197Help
Entry
Dd1591_2197       CDS       T00930                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
dze  Dickeya zeae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dd1591_2197
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd1591_2197
   00620 Pyruvate metabolism
    Dd1591_2197
   00650 Butanoate metabolism
    Dd1591_2197
  Lipid metabolism
   00071 Fatty acid degradation
    Dd1591_2197
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dd1591_2197
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dd1591_2197
   00626 Naphthalene degradation
    Dd1591_2197
Enzymes [BR:dze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dd1591_2197
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Dd1591_2197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2523832..2526534
Genome map
AA seq 900 aa AA seqDB search
MAVTNVAELNALVERVKKAQQEFANFTQEQVDRIFRAAALAAADARIPLAKMAVAESGMG
IIEDKVIKNHFASEYIYNAYKDEQTCGVLSVDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIVAGAPKDIIGWIDEPSVDLSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDEIYDAVRERFSTHGGYLLKGKELQAVQAIILKNGALNAAIVGQP
ATKIAEMAGISVPASTKVLIGEVTNADESEPFAHEKLSPTLAMYRAKDFEDAVNKAEKLV
AMGGIGHTSCLYTDQDNQARRVNYFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINRKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVASDGAK
RAFIVTDRFLFNNGYVDQITSVLKQQGLDTDVFFEVEADPTLSIVRKGAEQMNAFKPDVI
IALGGGSPMDAAKIMWVMYEHPDTHFEELALRFMDIRKRIYKFPKMGVKAKLIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHSLE
AYVSVLANEYSDGQALQALKLLKENLPASYHEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEVAD
HLGLGAAGDRTAQKIEKLLAWLESMKKELGIPTSIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLIAELKQILLDSFYGRPFIEHTAADTKATPAVASTAAKTEKSEKKEKKAVN
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaacaaacgttgctgaacttaacgctttggtcgaacgcgtcaaaaaagcgcag
caggaattcgcgaatttcactcaggagcaggtcgatcggatcttccgcgccgccgcgctg
gctgccgctgatgcccgtattccgctggcaaaaatggccgtcgccgaatccggtatgggg
attatcgaagacaaggtcatcaaaaaccacttcgcctccgagtacatttataacgcctat
aaggatgagcaaacctgcggcgtgctgtccgtcgatgataccttcggtacgattactatc
gctgagcctatcggcctgatctgcggtatcgttccgaccacgaaccccacctctaccgct
attttcaaggcgttaatcagcctgaaaacccgtaacggcattattttctctccccaccca
cgagccaaaaacgccaccaacaaggcggcagacatcgtgttgcaggcagccatcgttgcg
ggcgcgcctaaagatattatcggctggattgatgaaccgtcggtagacctgtccaatcag
ctgatgcaccacccggatatcaacctgatcctggcgacaggcgggccgggtatggtcaaa
gcggcctacagctcgggtaaaccggctattggcgtgggtgcaggcaacacgccggtcgtc
gttgatgaaaccgcggatatcaaacgagcggtagcatcgattttgatgtcgaaaaccttc
gacaacggtgtgatttgcgcatccgaacaatcggttatcgtggttgatgaaatctatgat
gccgtacgcgaacgcttctcgacacatggcggctacctgcttaaagggaaagaattgcag
gcggtacaggcgattattttgaaaaacggcgcgctcaatgccgccatcgtcggccaaccg
gccaccaaaatcgcagaaatggcgggcatttccgtaccagccagcaccaaggtattgatc
ggcgaagtaacgaatgccgacgaatccgaaccgtttgctcacgagaagctctccccgaca
ctggcgatgtatcgggcgaaagattttgaagacgccgtcaacaaagcggaaaaactggtc
gccatgggggggatcggtcatacctcctgcttgtataccgatcaggacaaccaggcgcgt
cgcgtcaattatttcggcgacaagatgaaaaccgcgcgtattctgatcaatacgccggcg
tcacaaggcggcatcggcgacctgtataactttaagctggcgccgtcgttgacgctgggc
tgcggctcatggggcggtaactccatctctgaaaacgtcggaccgaagcacctgatcaac
cgtaaaaccgtggctaagcgagctgaaaacatgctgtggcacaaacttcccaaatcgatc
tacttccgtcgcggctccctgccgatcgcgctggaagaagtggcgagcgatggtgcaaaa
cgcgcgtttatcgtgaccgaccgtttcctgtttaacaacggctatgtcgaccagatcact
tccgtactgaaacaacaaggtctggataccgatgtcttctttgaagtagaagccgaccca
acgctcagtatcgttcgcaaaggcgcggaacagatgaacgcgttcaaacccgacgtgatt
atcgcgctaggtggcggttcgccgatggatgccgccaagatcatgtgggttatgtacgaa
cacccggatacccattttgaagaactggcgctgcgtttcatggatatccgcaaacgtatc
tacaagttcccgaaaatgggcgtaaaagccaaactgatcgccgtcacgacgacctcaggt
acaggttctgaagtaacgccgttcgccgtcgtgaccgacgatgccaccggtcagaaatac
ccgttggccgactatgcgctgacgccggatatggcgattgtcgacgccaatctggtgatg
aacatgccgaaatcgctgtgtgcattcggcggtctggatgccgtcacccactcgctggaa
gcctatgtttccgtattggcgaacgaatactccgacggacaagcgttacaagcgctgaaa
cttctgaaagaaaatctgccggccagctaccatgaaggcgccaaaaacccggttgcccgc
gaacgcgtccacaatgcggcaaccattgccggcatcgcgtttgccaacgccttcctgggc
gtctgccactccatggcgcataaactggggtctgagttccatatcccacatggtctggcc
aacgcactgttgatttgtaacgtgattcgttataacgccaacgataacccgaccaaacag
accgcgttcagtcaatatgaccgcccgcaggcacgtcgtcgttatgcggaagtagccgat
cacctcggtctgggtgccgcgggcgaccgtaccgctcagaaaatcgagaaactgttggcc
tggctggaaagcatgaagaaagagttgggtatcccaacctctatccgtgaagctggcgta
caagaagccgacttcctggccaaagtggacaaactttctgaggatgctttcgacgatcag
tgcaccggcgccaacccgcgttacccgctgattgccgaactgaaacagatcctgctggat
tcattctacggccgtccgtttattgagcataccgctgccgacaccaaagcaactccggca
gttgccagtaccgcggctaaaacagaaaaaagcgagaaaaaagagaaaaaagcggtcaac
tga

DBGET integrated database retrieval system