KEGG   Dickeya zeae Ech1591: Dd1591_2200Help
Entry
Dd1591_2200       CDS       T00930                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dze  Dickeya zeae Ech1591
Pathway
dze00040  Pentose and glucuronate interconversions
dze00052  Galactose metabolism
dze00500  Starch and sucrose metabolism
dze00520  Amino sugar and nucleotide sugar metabolism
dze01100  Metabolic pathways
dze01130  Biosynthesis of antibiotics
Module
dze_M00362  Nucleotide sugar biosynthesis, prokaryotes
dze_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dd1591_2200
   00052 Galactose metabolism
    Dd1591_2200
   00500 Starch and sucrose metabolism
    Dd1591_2200
   00520 Amino sugar and nucleotide sugar metabolism
    Dd1591_2200
Enzymes [BR:dze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dd1591_2200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 PHZA_PHZB
Motif
Other DBs
NCBI-ProteinID: ACT07043
JGI: Dd1591_2200
UniProt: C6CIJ8
Position
complement(2528663..2529574)
Genome map
AA seq 303 aa AA seqDB search
MSTINKKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLNEVQSICPEHVTIMQVRQGLAKGLGHAVL
CAHPLVGDEPVAVILPDVIIDEYESDLKKDNLSEMLQRFYSTGHSQIMVEPVENVSSYGV
VDCKGVELKPGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSEQIWDLLKKTEPGAGNEIQ
LTDAIAMLMEKETVEAYHLKGVSHDCGNKLGYMAAFVEYGIRHDALGEDFTHWLKEAIEE
DAK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactattaataaaaaagtaaggaaagcggtcattccagtggccgggttagggacg
cgcatgttgcctgctaccaaggcaattcccaaagaaatgctgcctctggtcgataagccg
ctaatccagtatgtggttaatgaatgcattgctgccggtatcaatgaaataattttagtt
acacattcttccaagaactcaatagaaaaccattttgataccagctttgaactggaagcc
atgttggaaaaacgtgttaagcgccagttgttgaacgaagtgcaatctatttgtccggag
catgtcactattatgcaggttcgtcagggactggcgaaaggattaggacatgcggtgctt
tgtgctcatcctttagtgggagatgaaccggtagcggttattttaccggacgtgatcatc
gatgaatatgaatctgatctgaagaaagacaacctcagcgaaatgttgcaacgtttttat
agcacaggccatagccagattatggttgagccggtggaaaacgtcagcagttatggcgta
gttgattgcaaaggtgtggaattaaaaccgggtgatagcgcgccgatggtcggtgtagtc
gaaaaaccgaaagcatcagaagcaccgtccaatttagcggttgttgggcgttatgtgcta
tctgagcagatctgggatctgctgaagaaaacagagcccggcgcaggtaatgaaattcag
ctgaccgatgctattgccatgctgatggaaaaagaaaccgttgaagcttatcacctgaaa
ggggtaagccatgactgcggaaataaactgggatacatggccgcgtttgtagaatatggt
attcggcatgatgcgttgggtgaagattttacccactggctgaaagaagcaatagaagaa
gacgccaaataa

DBGET integrated database retrieval system