KEGG   Dickeya zeae: Dd1591_2454Help
Entry
Dd1591_2454       CDS       T00930                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dze  Dickeya zeae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dd1591_2454
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dd1591_2454
Enzymes [BR:dze01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dd1591_2454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2809353..2809835
Genome map
AA seq 160 aa AA seqDB search
MTPFHQLTATSLSGQLIAMADYAGKVVLVVNTASHCGFTPQYGGLEALYQKYAAQGLVVL
GFPCNQFGKQEPGNADEIAQTCHINYGVSFPMFEKVDVNGTTAHPVFRYLKNELPGVLGG
RIKWNFTKFLIGRDGKPLKRFAPFTTPEKMEATILAALEI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacgccctttcatcaacttacagccaccagcctgagtggccagcttatcgctatggcc
gactacgcaggtaaggtggttctggtcgttaataccgccagccattgcggcttcacgcca
caatacggcggccttgaagcgctctaccaaaaatacgctgcccagggtttggtggtactg
ggcttcccctgcaaccagttcggtaaacaggaacccggcaacgccgacgaaatcgcgcag
acttgtcacattaactatggcgtgagcttcccgatgttcgagaaagtagacgtcaacggc
accacagcgcacccggtgttccgttatctgaaaaacgaattgcccggcgtgctgggtggg
cgaatcaagtggaacttcactaagttcctgatcggtcgcgacggtaaaccgctcaagcgg
tttgcaccgttcaccaccccggagaaaatggaagccacaatccttgcggcacttgaaatc
taa

DBGET integrated database retrieval system