KEGG   Dickeya zeae: Dd1591_2469Help
Entry
Dd1591_2469       CDS       T00930                                 

Definition
putative pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
dze  Dickeya zeae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dd1591_2469
   00500 Starch and sucrose metabolism
    Dd1591_2469
Enzymes [BR:dze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Dd1591_2469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2818504..2819808
Genome map
AA seq 434 aa AA seqDB search
MSLTHYSGLAAAVSMSILLTACGSQMPNHSARFQPVFPGTASRPVLSAQEAERFTPQHYF
AHGGKYARPITDGWMPTPIETAHVVAAYVVGPRVGVAGVTHTSIQQAVNAALRQHPGQTR
VYIKLLPGTYTGTVYIPEGAPPLTLFGAGDRPEQVVVSLALDSMMSPADYRARVNPHGQY
QPTDPAWYMYDVCASKPGTTINTTCSAVMWSQSNDFQLKNLTVVNALLDTVDSGTHQAVA
LRTDGDRVQLENVRLLGRQDTFFVNTSDRQNGYVTDHYSRAYIKDSYIEGDVDYVFGRAT
AVFDGVRFHTVSSRGSKEAYVFAPDSIPSVKYGFLVINSRLTGDSGYRGTQKAKLGRAWD
QGAKQTGYLPGKTANGQLVIRDSTIDSSYDLVNPWGTAATTDRPFKGNINPQRHLDDLHF
NRLWEYNTQVLLHE
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctgacacactattccgggctggccgccgcggtctctatgtcaattcttctgacc
gcctgcggcagccagatgccgaatcattcggcgcgttttcagccggtttttcccggcacc
gccagtcgcccggtgctgtcggcacaggaggccgaacgcttcacaccacaacactatttc
gcccacggcggtaaatacgcccgaccgataacggatggctggatgccaaccccgattgaa
accgcacatgtcgtcgccgcttatgtcgtcggcccgcgcgtgggtgtagccggcgttacc
cacaccagcattcagcaagcggtgaatgctgcgctacgtcagcatccaggccagacgcga
gtatacataaaactgctgccaggcacctatacaggtacggtatacatccccgagggcgcg
ccgccgctgacgttattcggtgccggtgaccggccggaacaggtagtcgtgtcgctggcg
ctggattcaatgatgtcaccggccgactaccgcgcccgcgtcaatccgcacggtcagtat
cagccgaccgatccggcctggtatatgtacgatgtctgcgcttcaaaaccgggcacaacc
atcaataccacctgttcagccgtgatgtggtcacagagcaacgattttcagttgaaaaac
ctgacggtggtgaatgcgctgctggatacggtggacagcggtacgcatcaggcggttgcg
ctacgtaccgacggcgaccgggtgcaactggaaaacgttcgcctgctcggccgtcaggac
acctttttcgtcaataccagcgatcgccaaaacggctatgtcaccgatcattacagccgc
gcctacatcaaagacagctacattgaaggggatgtggattatgtgttcggtcgcgccact
gccgtgtttgacggggtgcgattccataccgtgtccagccgtggttcaaaagaagcctat
gtgttcgcaccggacagtattccgtcggtgaaatacggttttctggtgatcaacagccgg
ttgaccggcgacagcggttatcgcggcacgcagaaagccaaactggggcgcgcctgggat
cagggtgcgaaacagacgggttacctgccggggaaaaccgccaacggccagttggtgatc
cgcgacagtaccattgacagcagctacgacctcgtcaacccgtgggggaccgccgccacc
accgaccggccgttcaagggcaatatcaacccgcaacgccatctggacgacctccacttc
aaccggttgtgggagtacaacacccaggtgctgctgcacgagtaa

DBGET integrated database retrieval system