KEGG   Dickeya zeae: Dd1591_2658Help
Entry
Dd1591_2658       CDS       T00930                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
dze  Dickeya zeae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dd1591_2658
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dd1591_2658
   00600 Sphingolipid metabolism
    Dd1591_2658
Enzymes [BR:dze01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dd1591_2658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3014857..3016986)
Genome map
AA seq 709 aa AA seqDB search
METTLIRLTSPVTDVIVRCRPAAEILYWGPHLAAFSPQDAESLSRPVANGRLDVDVPVTL
AAETGRGLFGSPGIEGHRNGLDAFAVLTTVAVRQPDPQQLVIEAEDRQAGLRLTSELRLH
ADSGVLQLRHCLTNLHPGDWQVQRLAVTLPLPESAAEVMAFHGRWVREFQPHRTLLAHGS
LVQENRRGRTSHEYFPAMVSGEPGFAEQHGQVWGAHLGWSGNHRLRTEVKTDGRRLVQAE
ALYLPGEITLAQGESLTTPWLYAACSEQGLNGMSQQFHRFLRQEIIRFPHAKARPVHLNT
WEGIYFKHDPAYIMQMATQAAALGVERFIIDDGWFRGRDHDRAALGDWYVDSDKYPQGLM
PVINHVRDLGMEFGIWVEPEMINPDSDLYRAHPDWLLALPGYDQPTGRYQYVLDLSNPEA
FDYLLARLSWLLGEHPIDYVKWDMNRELVQPAHQGRAAADRQTKAFYRLLDVLGERFPQV
EFESCASGGGRIDYEVLRRCHRFWASDNNDALERQTIQRGMSYFFPPEVMGAHIGHHRCH
ATGRQHGIAFRGLTALFGHMGIELDPVRADAQEQAGFRHYVALHRQYRTLLHTGCLWRVD
MADAATQVQGVVSEDRRQALFLITQLAMPDYALAGVLRVPGLDAQARYRLTVVDHPDLKP
VIEGGSTMRQLPTWMAAPAEYSGEWLMKAGLRLPILNPETALLLELERL
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaacgttgattcgtctcaccagcccggtgaccgacgtgattgtgcgctgccgg
ccggcggcggaaatactgtactggggcccgcatctggcggcgttttcaccgcaggatgcg
gaaagtctgtcgcggccggtggcgaacggccggctggatgtggatgtgccggtaacgctg
gcggcggaaaccggacgggggctgttcggttcgccgggcattgaagggcatcgcaacggt
ctcgatgcctttgcggtgctaaccaccgtcgcggtgcgtcagccggacccgcagcaactg
gtcattgaagcggaagaccgtcaggccggcctgcgcctgaccagcgaattgcggctgcac
gccgacagcggggtactgcaactgcgccactgcctgactaacctgcatccgggcgactgg
caggtgcaacggctggcggtcacgttaccgttgccggagtcggcggcggaggtgatggcg
tttcacggccgctgggtgcgggaatttcagccgcaccgtacgctgttagcgcacggcagt
ctggtgcaggaaaaccgccgcgggcgcacgtctcacgaatattttccggcgatggtgagc
ggcgaaccgggatttgccgaacagcacggtcaggtgtggggggcgcacctcggctggagc
ggcaaccatcggttgcgtacggaagtgaaaaccgatggccggcggctggtgcaggcagag
gcactctacctgcccggtgaaatcacgctggcgcagggggagtcgctgactacaccgtgg
ctgtacgccgcctgttctgagcaggggctcaacggcatgagccagcagtttcaccgcttt
ttgcgtcaggagattattcggtttccgcacgccaaagcgcgcccggtccaccttaacacc
tgggaaggcatctactttaagcatgacccggcctacatcatgcagatggcgacgcaggcc
gcggcgctgggcgtcgagcgttttatcatcgacgatggctggtttcgcgggcgcgaccat
gaccgtgccgcgctcggcgactggtacgtggactcggataaatatccgcaagggctgatg
ccggtgataaaccatgtgcgggatctgggcatggagttcggtatttgggtcgaaccggaa
atgatcaacccggattccgatctctatcgtgcacacccggattggctgttggcgctgccc
ggctacgatcagccgaccggccgctatcagtatgtgctcgacttgtctaaccccgaggcg
ttcgattacctgctggcgcgcctgagctggctgctgggcgaacacccgatcgactacgtg
aaatgggatatgaaccgcgagttggtgcaaccggctcatcaggggcgggcggcggccgac
cgccagaccaaggcgttttatcgtctgctcgatgtgctgggcgagcgcttcccgcaggtg
gagtttgagtcttgcgcgtcgggcggtgggcgcatcgattatgaagtgttgcggcgttgc
caccgtttctgggcatccgacaacaacgatgcgctggaacggcagacgattcagcgcggc
atgagttacttcttcccacctgaagtgatgggcgcgcacatcggtcaccaccgctgtcac
gctaccggacgtcagcacggcattgcttttcgcggcctgacggcgctgttcggccatatg
gggatcgaactggacccggtacgtgccgatgcgcaggaacaggccggttttcgccattac
gtggcgctgcaccgccagtatcgcacgctgttgcacaccggctgcctgtggcgcgttgac
atggccgatgccgctacgcaggtgcagggggtggtcagcgaggataggcgtcaggcgctg
tttctgataacgcaactggcgatgccggattacgcgctggccggggtgctgcgtgtcccc
ggtctggacgcgcaagcccgttaccgactgaccgtggtagaccaccctgacctgaaaccg
gtcatcgagggcggcagcaccatgcggcagttgccgacatggatggcggcaccggctgaa
tatagcggcgaatggttgatgaaagccgggctgcgtctgcctattctcaacccggaaacg
gcgctgttgctggaactggaacgtctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system