KEGG   Dickeya zeae: Dd1591_2848Help
Entry
Dd1591_2848       CDS       T00930                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dze  Dickeya zeae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dd1591_2848
   00052 Galactose metabolism
    Dd1591_2848
   00500 Starch and sucrose metabolism
    Dd1591_2848
   00520 Amino sugar and nucleotide sugar metabolism
    Dd1591_2848
Enzymes [BR:dze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dd1591_2848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3240754..3241653)
Genome map
AA seq 299 aa AA seqDB search
MTALKAIIPVAGLGMNLLPVTKAIPKEMLPLVDRPVIEKIVNECVNAGIKEIVLVTHASK
NAIENHFDTSFELESMLEERAKRQLLAEVKSICPPGVTIMNVRQGQTLGLGHAVSCAHPI
VGNAPFVVVLPDVVMDDSSADQSKDNLALLISRFEETGHSQVLVKHRPYEVLPEYSIVEC
EKPLNQAGDASAITSMIEKPELAPVEGSDLSAVGRYVLTAEAWPILENIMAGAWGRIQLT
DAIAELIKTQQVDAVQMTGRSFNCGRKMGYVQAFVSYGLRNPELGDAFKTKIQALLEKY
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacagcattaaaagcgattatccccgttgccggcttagggatgaatttgttgccggtt
accaaagcgattccgaaagagatgcttccgttggttgatcggccggtcatcgaaaagatt
gtcaacgagtgcgtcaatgcggggattaaagagattgtgctggtgacgcacgcctctaaa
aacgccattgaaaaccattttgatacctcttttgagctggaatcgatgctggaagagcgc
gccaaacgtcagttgctggcggaagttaagtccatttgcccgccgggcgtgaccattatg
aacgtgcgtcaggggcagacgctgggcctggggcacgcggtgtcctgcgctcacccgatt
gtcggcaacgcgccgtttgtggtggtgctgccggatgtggtgatggacgacagctccgcc
gatcagtcaaaagacaatctggcgttgctgatttcccgttttgaagaaaccggccacagc
caggtgctggtaaaacaccgcccgtacgaagtcttgccggaatactccatcgtggaatgc
gagaagccgctgaatcaggcgggcgacgcgtcggcgatcacctccatgattgagaaaccg
gaactggcgccggtggaaggctctgacctgtccgcggttggccgttatgtgctgacggcc
gaagcctggccgattctggaaaacatcatggcgggtgcgtggggtcgtatccaactgacc
gacgccatcgctgagcttatcaaaacccagcaggtggatgcggttcagatgacgggacgc
agcttcaactgcggccggaagatgggttatgtgcaggcgtttgtctcctacggcctgcgt
aatccggaactgggcgacgccttcaaaaccaaaatccaggcattgctggagaaatattaa

DBGET integrated database retrieval system