KEGG   Dickeya chrysanthemi: Dd1591_2857Help
Entry
Dd1591_2857       CDS       T00930                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00521  Streptomycin biosynthesis
dze00523  Polyketide sugar unit biosynthesis
dze01130  Biosynthesis of antibiotics
Module
dze_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Dd1591_2857
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dd1591_2857
Enzymes [BR:dze01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Dd1591_2857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACT07679
JGI: Dd1591_2857
UniProt: C6CP04
Position
complement(3251522..3252058)
Genome map
AA seq 178 aa AA seqDB search
MQVRDTAIQGVKIIQPKVFGDARGFFLETFEKKRYQEMLDIDLDFVQDNHSRSARGVLRG
LHFQTVNPQGKLVRVVRGEVFDVVVDIRPDSATYGRWEGVLLSEENKAQFWIPPGLAHGF
VVLSDLADFEYKCTDYYNPAHEGCLLWNDPDIGIDWPIASPLLSEKDSKGKTFKELWA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttcgtgataccgccattcagggcgtcaaaatcatccaacctaaggtctttggc
gatgcacggggcttttttctggaaacgtttgagaaaaagcgctaccaggagatgctggat
atcgacctggattttgtgcaagacaaccactcccgttcggccagaggcgtgttgcgcggg
ctgcattttcagaccgtcaatccgcaagggaaactggtgcgcgtggtgcgtggcgaagta
tttgacgtcgtggtggatattcggcccgactcggcgacatacggtcgctgggaaggggtt
ctcctgtcggaggagaataaggcccaattctggatcccgcccggtctggcgcacggtttt
gtggtgctctccgacctggcggatttcgagtacaagtgcaccgactactacaacccggct
cacgaagggtgcctgttatggaatgatccggatatcggcatcgattggccgatcgcctcg
cctttgttatcggaaaaagatagcaaaggtaaaacatttaaggagctatgggcatga

DBGET integrated database retrieval system