KEGG   Dickeya chrysanthemi: Dd1591_2895Help
Entry
Dd1591_2895       CDS       T00930                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00010  Glycolysis / Gluconeogenesis
dze00260  Glycine, serine and threonine metabolism
dze00680  Methane metabolism
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01120  Microbial metabolism in diverse environments
dze01130  Biosynthesis of antibiotics
dze01200  Carbon metabolism
dze01230  Biosynthesis of amino acids
Module
dze_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dze_M00002  Glycolysis, core module involving three-carbon compounds
dze_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd1591_2895
  Energy metabolism
   00680 Methane metabolism
    Dd1591_2895
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dd1591_2895
Enzymes [BR:dze01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dd1591_2895
Membrane trafficking [BR:dze04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Dd1591_2895
Exosome [BR:dze04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dd1591_2895
  Exosomal proteins of melanoma cells
   Dd1591_2895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACT07717
JGI: Dd1591_2895
UniProt: C6CPR4
Position
3298568..3299320
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWMDVDLSEKGVNEAKQAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKCWKLNERHYGALQGLNKAETAEKYGDDQVKLWRRGFA
VTPPELTRDDERFPGHDPRYASLSDKELPLTESLALTIERVVPYWNENILPRIKKGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTAVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggtgcgacatggtgagagccagtggaacaacgaaaac
cgcttcaccggctggatggacgttgatctgtccgaaaaaggcgtcaatgaagccaaacag
gcaggtaaactgctgaaagaagaaggtttcagctttgattttgcctacacctctgtgctg
aaacgtgccattcacaccctgtggaacgtgctggacgagttggatcaggcctggctgccg
gtagaaaaatgctggaaactgaacgaacgtcactacggtgcgttgcagggcctgaacaag
gcagaaaccgctgagaaatacggtgacgatcaggtgaaactgtggcgtcgtggtttcgcg
gttactccgccggaactgacccgtgacgacgagcgtttccctggccacgacccgcgttac
gcatcgctgagcgataaagagctgccgctgaccgaaagtctggcgctgactatcgaacgc
gtagtgccgtactggaatgaaaacattctgccgcgtatcaaaaaaggcgagcgcgtgatc
atcgccgctcacggcaactcactgcgtgcgctggtgaaatatctggataacatgagcgaa
gaagaaattctggagctgaatatcccgaccgccgtaccgctggtttacgaattcgacgaa
aacttcaaaccgatcaaacgctactatctgggcaatgccgacgagatcgcggccaaagca
gccgcagtagcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system