KEGG   Dickeya zeae Ech1591: Dd1591_2895Help
Entry
Dd1591_2895       CDS       T00930                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dze  Dickeya zeae Ech1591
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd1591_2895 (gpmA)
   01230 Biosynthesis of amino acids
    Dd1591_2895 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd1591_2895 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Dd1591_2895 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dd1591_2895 (gpmA)
Enzymes [BR:dze01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Dd1591_2895 (gpmA)
Exosome [BR:dze04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Dd1591_2895 (gpmA)
  Exosomal proteins of melanoma cells
   Dd1591_2895 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3298568..3299320
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWMDVDLSEKGVNEAKQAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKCWKLNERHYGALQGLNKAETAEKYGDDQVKLWRRGFA
VTPPELTRDDERFPGHDPRYASLSDKELPLTESLALTIERVVPYWNENILPRIKKGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTAVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggtgcgacatggtgagagccagtggaacaacgaaaac
cgcttcaccggctggatggacgttgatctgtccgaaaaaggcgtcaatgaagccaaacag
gcaggtaaactgctgaaagaagaaggtttcagctttgattttgcctacacctctgtgctg
aaacgtgccattcacaccctgtggaacgtgctggacgagttggatcaggcctggctgccg
gtagaaaaatgctggaaactgaacgaacgtcactacggtgcgttgcagggcctgaacaag
gcagaaaccgctgagaaatacggtgacgatcaggtgaaactgtggcgtcgtggtttcgcg
gttactccgccggaactgacccgtgacgacgagcgtttccctggccacgacccgcgttac
gcatcgctgagcgataaagagctgccgctgaccgaaagtctggcgctgactatcgaacgc
gtagtgccgtactggaatgaaaacattctgccgcgtatcaaaaaaggcgagcgcgtgatc
atcgccgctcacggcaactcactgcgtgcgctggtgaaatatctggataacatgagcgaa
gaagaaattctggagctgaatatcccgaccgccgtaccgctggtttacgaattcgacgaa
aacttcaaaccgatcaaacgctactatctgggcaatgccgacgagatcgcggccaaagca
gccgcagtagcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system