KEGG   Dickeya zeae: Dd1591_2913Help
Entry
Dd1591_2913       CDS       T00930                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dze  Dickeya zeae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd1591_2913
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dd1591_2913
  Amino acid metabolism
   00310 Lysine degradation
    Dd1591_2913
Enzymes [BR:dze01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dd1591_2913
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3316015..3317241)
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPALEAGVLEVV
LEGEGATVTSRQVLGRLRPGDNSGKETSEKAQSKESTPAQRHTAGLEDENNDALSPAIRR
LIAEHDLDASAIKGSGVGGRITREDVEKHLAGQKSAAKPAEASAAASAQPAPALASRSEK
RVPMTRLRKRVAERLLEAKNNTAMLTTFNEVNMQPIMDLRKQYGEAFEKRHGVRLGFMSF
YIKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLKDVDLLGMAEIEK
KIKELAVKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VDGQVVILPMMYLALSYDHRLIDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgtccctgacctgccggaatccgtagctgacgcgacagtc
gctacctggcacaagaaaccgggcgatagcgtccagcgtgatgaagtgctggttgagatt
gaaaccgacaaagtggtgctggaagtgcctgcgcttgaagcgggcgtattggaagtggtg
ctggaaggggaaggcgcgacggtgacatcacgccaggtgttggggcgtctgcgtcctggc
gataattccggcaaagaaaccagcgaaaaagcacaaagtaaagagtctactccggcacag
cgccacaccgccgggttggaagatgagaataacgacgccttgagcccggctattcgtcgc
ctgattgctgaacatgatctggatgcctcggcgattaagggcagcggcgtcggcgggcgt
atcacgcgtgaagatgtggaaaaacacctggcagggcagaagtcggcggctaagccggct
gaggcatctgccgctgcgtcggcgcagcctgctccggccttggcgagccgcagcgagaaa
cgtgttcctatgacccggttgcgcaaacgcgttgctgagcgtctgctggaagcgaaaaac
aataccgcgatgttgactacgtttaatgaagtcaacatgcaaccgatcatggacctgcgc
aagcaatacggtgaggcgtttgaaaaacgtcatggcgttcgtctgggtttcatgtccttc
tatatcaaagcagttgtagaagcactgaaacgttatccggaagtgaatgcatctattgat
ggcgaagatgtggtttaccacaactacttcgacgtcagtatcgccgtgtctactccgcgc
ggcctggttacaccggtgctgaaagatgtcgatctgctgggtatggctgagatcgagaag
aaaatcaaagaactggcggtgaaaggtcgtgacggcaaactgaccgtcgaagagctgacc
ggcggcaacttcaccatcactaacggcggcgtgtttggctcgttgatgtcgaccccgatt
atcaatccgccgcagagcgcgattctggggatgcatgccatcaaagatcgtcctatggcc
gttgacggccaggttgtgatcctgccgatgatgtatctggcgctgtcttacgaccatcgt
ttgatcgatgggcgggaatcggtcggtttcctggttaccgtgaaagaaatgctggaagac
ccggctcgcttgctgctggatgtctaa

DBGET integrated database retrieval system