KEGG   Dickeya zeae Ech1591: Dd1591_2917Help
Entry
Dd1591_2917       CDS       T00930                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dze  Dickeya zeae Ech1591
Pathway
dze00020  Citrate cycle (TCA cycle)
dze00190  Oxidative phosphorylation
dze00650  Butanoate metabolism
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01120  Microbial metabolism in diverse environments
dze01130  Biosynthesis of antibiotics
dze01200  Carbon metabolism
Module
dze_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dze_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dze_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dd1591_2917
   00650 Butanoate metabolism
    Dd1591_2917
  Energy metabolism
   00190 Oxidative phosphorylation
    Dd1591_2917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACT07739
JGI: Dd1591_2917
UniProt: C6CPT7
Position
complement(3322810..3323157)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLIRASAIVIVLYVLYIVGFVASAGHITYEVWRGFFAMHLTKVF
TLLTLFAILVHAWIGMWQVLTDYIKPLAIRLTLQLAIVVALLVYVIYGTVVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcctccgcattggggcgtaatggcgtacacgattggttgttaattcgc
gcttctgccatcgtcatcgtgctgtatgtcctttatatcgttggttttgtggccagcgcc
ggccacatcacatatgaagtctggcgcggtttcttcgccatgcatctcaccaaggtgttc
accctgctgactttattcgccattctggtccatgcctggatcgggatgtggcaggtgttg
actgactacatcaaaccgctggctattcggctgaccttacagctggctattgtggtcgcg
ttgttggtgtatgtcatttatggaactgttgtggtgtggggtgcgtaa

DBGET integrated database retrieval system