KEGG   Dickeya chrysanthemi: Dd1591_2945Help
Entry
Dd1591_2945       CDS       T00930                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00250  Alanine, aspartate and glutamate metabolism
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dd1591_2945
Enzymes [BR:dze01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dd1591_2945
Peptidases [BR:dze01002]
 Cysteine Peptidases
  Family C44
   Dd1591_2945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: ACT07767
JGI: Dd1591_2945
UniProt: C6CPW6
Position
3354981..3356645
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLDLKTDPVELRKKALELSRLMRHRGPDWSGVYASDKAILAHERLSIVDVNTGA
QPLYNQAHTHVLAVNGEIYNHQALRQQYGDRYQFQTGSDCEVILALYQEKGPEFLDDLRG
MFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGNFYVASEMKALVPVCRTIKEFPAGSY
LWSKDGEIREYYRRDWFDYDNVKDNVTDAEELREALEESVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDDERSEAWWPQLHSFAVGLEGAPDLKAARDVADHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHQYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPKD
KMCGNGKMEKHILRECFESYLPHSVAWRQKEQFSDGVGYSWIDTLKEVAAKQISDQQLET
AHFRFPYNTPTTKEGYLYREIFEELFPVPSAAECVPGGPSVACSSAKAIEWDESFKKMDD
PSGRAVGVHQSAYQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctatttttggtgtgcttgatctgaaaaccgacccggttgaactgcgcaagaaa
gcgctggagttatcccgtctgatgcgccaccgcggcccggactggtccggcgtttatgcc
agcgacaaagccattctggcacacgagcgtttgtccatcgtcgacgtcaacaccggtgct
cagcctctctataaccaggcacatacccacgttctggccgtgaacggtgaaatttataac
catcaggctctgcgtcaacagtacggcgaccgctaccaattccagaccggctcggattgt
gaagtcattctggcgctgtatcaggaaaaaggcccggaattcctggacgatctgcgcggt
atgttcgccttcgcattgtatgacagtgaaaaagacgcttatttgatcggccgtgatcac
ctgggcatcatcccgctgtatatgggttacgacgaacacggtaacttctatgttgcctct
gaaatgaaagcgctggtgccggtatgccgcacgatcaaagaattcccggccggtagttat
ctgtggagtaaagacggcgaaattcgcgagtattatcgccgcgactggttcgattacgac
aacgtgaaagataacgtcaccgatgccgaagaactgcgtgaagcattggaagagtcggtg
aaaagccacctgatgtccgatgtaccttatggtgtattgctgtccggcgggctggattct
tccgtcatttccgccatcaccaaaaaattcgccgcccgccgagtggaagatgacgagcgc
agcgaagcctggtggccacagcttcactcgttcgccgttggcctggaaggcgcgcctgac
ctgaaagccgcacgcgatgttgcagaccacctcggcaccgtgcaccacgaaatccatttc
acggtacaagaaggcctggacgctattcgcgacgtgatctatcacatcgaaacttacgat
gtcaccaccatccgcgcctcaacgccaatgtacctgatgtcgcgtaaaatcaaggcgatg
ggtatcaaaatggtgctgtcgggcgaaggttccgatgaagtattcggcggctatctctac
ttccacaaagcgccgaacgcgaaagaacttcatgaagaaaccgtgcgtaaactgctggcg
ctgcaccagtacgattgcgcccgcgccaacaaagcgatgtcggcctggggcgttgaagcg
cgcgtaccgttcctggacaaaaaattcctggatgtggcaatgcgcatcaacccgaaagac
aaaatgtgcggcaacggcaaaatggaaaaacacattctgcgtgaatgcttcgaatcctat
ttgccgcacagcgtggcctggcgccagaaagagcagttctccgacggtgtgggttacagt
tggatcgatacgttgaaagaagtagccgccaaacagatttccgatcagcaactggaaacc
gcacacttccgtttcccgtacaacacgccgaccaccaaagaaggctatctgtaccgcgaa
atttttgaagaactgttcccggttcccagtgcggctgaatgcgtccctggcggcccatcc
gtcgcgtgttcgtccgctaaagcgatcgagtgggatgaatccttcaaaaagatggatgac
ccatcaggtcgcgccgtcggcgtacatcagtccgcctatcaataa

DBGET integrated database retrieval system