KEGG   Dickeya zeae: Dd1591_3005Help
Entry
Dd1591_3005       CDS       T00930                                 

Definition
Lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dze  Dickeya zeae
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dze01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3418422..3418970
Genome map
AA seq 182 aa AA seqDB search
MVLGDSLSAGYRMAANQAWPALLDAAWQSRSPAVPVRVVNASISGDTATQGLSRLPALLK
QHQPRWVLVELGGNDGLRGFPPQNVERDLAGVISQIKTAGAQPLLMQIRLPANYGRRYTE
SFSAVYPRLAGTFSIPLLPFFMEQVYLKPEWMQDDGIHPTRDAQPFIAEWMAKQLDPIIN
QH
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttggtgctgggcgacagcctaagcgcaggctatcgcatggcggcaaatcaggcctggccg
gcgttgttggatgccgcctggcagtctcgctcgcccgccgttccggttcgggtggtgaac
gccagcatcagcggcgacaccgcaacgcaaggtctgtctcgcctgcccgctttactcaaa
caacaccaaccgcgctgggtgttggtcgagctcggcggcaatgacggcttgcgtggcttc
ccgccacaaaacgtagaacgggatctcgccggcgtcattagccagataaaaacagccgga
gcccagccgttactgatgcaaattcgcttaccagctaactacgggcggcgctataccgag
tcgttcagcgcagtttatccacgcctcgccggtacgtttagtattccgctgttgccgttt
ttcatggaacaggtttatctcaaaccggaatggatgcaggatgacggtatccatcccacc
cgtgacgcccagccgtttatcgccgaatggatggcaaaacagctcgaccccattattaac
cagcactga

DBGET integrated database retrieval system