KEGG   Dickeya zeae: Dd1591_3005Help
Entry
Dd1591_3005       CDS       T00930                                 

Definition
Lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dze  Dickeya zeae
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dd1591_3005
Enzymes [BR:dze01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dd1591_3005
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Dd1591_3005
Lipid biosynthesis proteins [BR:dze01004]
 Fatty acid synthase
  Component type
   Dd1591_3005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3418422..3418970
Genome map
AA seq 182 aa AA seqDB search
MVLGDSLSAGYRMAANQAWPALLDAAWQSRSPAVPVRVVNASISGDTATQGLSRLPALLK
QHQPRWVLVELGGNDGLRGFPPQNVERDLAGVISQIKTAGAQPLLMQIRLPANYGRRYTE
SFSAVYPRLAGTFSIPLLPFFMEQVYLKPEWMQDDGIHPTRDAQPFIAEWMAKQLDPIIN
QH
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
ttggtgctgggcgacagcctaagcgcaggctatcgcatggcggcaaatcaggcctggccg
gcgttgttggatgccgcctggcagtctcgctcgcccgccgttccggttcgggtggtgaac
gccagcatcagcggcgacaccgcaacgcaaggtctgtctcgcctgcccgctttactcaaa
caacaccaaccgcgctgggtgttggtcgagctcggcggcaatgacggcttgcgtggcttc
ccgccacaaaacgtagaacgggatctcgccggcgtcattagccagataaaaacagccgga
gcccagccgttactgatgcaaattcgcttaccagctaactacgggcggcgctataccgag
tcgttcagcgcagtttatccacgcctcgccggtacgtttagtattccgctgttgccgttt
ttcatggaacaggtttatctcaaaccggaatggatgcaggatgacggtatccatcccacc
cgtgacgcccagccgtttatcgccgaatggatggcaaaacagctcgaccccattattaac
cagcactga

DBGET integrated database retrieval system