KEGG   Dickeya chrysanthemi: Dd1591_3037Help
Entry
Dd1591_3037       CDS       T00930                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
dze  Dickeya chrysanthemi
Pathway
dze03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dze00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dd1591_3037
DNA repair and recombination proteins [BR:dze03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Dd1591_3037
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dd1591_3037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH Gln-synt_N_2 HHH_5
Motif
Other DBs
NCBI-ProteinID: ACT07859
JGI: Dd1591_3037
UniProt: C6CQR6
Position
complement(3464152..3464757)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMDALRCLPGVGPKSAQRMAFHLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCSICANPRRQQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
GDIGLDRLEERLVTETISEVILATNPTVEGDATANYIAELCAEHGVMASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHPIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgcttcttgaatcactgatggacgcgctgcgctgtttgcccggcgtg
gggccgaaatcggcgcaacgtatggcatttcatctgctgcagcgcgatcgcagcggtggt
atgcgtctggcgcaggcgctgacgcgtgccatgtccgagatcggtcattgtgccgactgc
cggacttttaccgagcaagaggtctgttccatctgcgctaatccacgccgtcagcaaaac
ggccagatttgcgtggtggaaagcccggcggatatccacgccatcgagcagaccgggcag
tttgccggccgctattttgtgttgatggggcatctgtcgccgctggatggcatcggcccc
ggcgatatcgggctggatcggctggaagagcgcttggtgacggaaaccatcagtgaagtg
attctggccaccaacccgacggtggaaggcgatgcaacggcgaactacatcgccgagctg
tgcgccgaacacggcgtcatggccagtcgtatcgctcacggtgtgccggtaggcggtgag
ctggaaatggtggacggcacgacgttgtcccactcgctggccgggcgtcatcctatccgg
ttctga

DBGET integrated database retrieval system