KEGG   Dickeya zeae: Dd1591_3037Help
Entry
Dd1591_3037       CDS       T00930                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dze  Dickeya zeae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dze00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dd1591_3037
DNA repair and recombination proteins [BR:dze03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dd1591_3037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3464152..3464757)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMDALRCLPGVGPKSAQRMAFHLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCSICANPRRQQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
GDIGLDRLEERLVTETISEVILATNPTVEGDATANYIAELCAEHGVMASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHPIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgcttcttgaatcactgatggacgcgctgcgctgtttgcccggcgtg
gggccgaaatcggcgcaacgtatggcatttcatctgctgcagcgcgatcgcagcggtggt
atgcgtctggcgcaggcgctgacgcgtgccatgtccgagatcggtcattgtgccgactgc
cggacttttaccgagcaagaggtctgttccatctgcgctaatccacgccgtcagcaaaac
ggccagatttgcgtggtggaaagcccggcggatatccacgccatcgagcagaccgggcag
tttgccggccgctattttgtgttgatggggcatctgtcgccgctggatggcatcggcccc
ggcgatatcgggctggatcggctggaagagcgcttggtgacggaaaccatcagtgaagtg
attctggccaccaacccgacggtggaaggcgatgcaacggcgaactacatcgccgagctg
tgcgccgaacacggcgtcatggccagtcgtatcgctcacggtgtgccggtaggcggtgag
ctggaaatggtggacggcacgacgttgtcccactcgctggccgggcgtcatcctatccgg
ttctga

DBGET integrated database retrieval system