KEGG   Dickeya chrysanthemi: Dd1591_3375Help
Entry
Dd1591_3375       CDS       T00930                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00010  Glycolysis / Gluconeogenesis
dze00620  Pyruvate metabolism
dze00640  Propanoate metabolism
dze00680  Methane metabolism
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01120  Microbial metabolism in diverse environments
dze01130  Biosynthesis of antibiotics
dze01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd1591_3375
   00620 Pyruvate metabolism
    Dd1591_3375
   00640 Propanoate metabolism
    Dd1591_3375
  Energy metabolism
   00680 Methane metabolism
    Dd1591_3375
Enzymes [BR:dze01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dd1591_3375
Lipid biosynthesis proteins [BR:dze01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dd1591_3375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF4157
Motif
Other DBs
NCBI-ProteinID: ACT08191
JGI: Dd1591_3375
UniProt: C6CIU5
Position
3840766..3842727
Genome map
AA seq 653 aa AA seqDB search
MSQYNKHPIPTAIAENALITAEQYKKMYQASVQDPDSFWREQGKIIDWIKPYQQVKNTSF
DPGHVRIRWFEDGTLNVAANCLDRHLATQGDQTAIIWEGDDAKESKKVTYRELHQAVCRF
ANVLKSKGISKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPESIAGRIVDSSA
KLVITADEGVRAGRTIPLKKNIDEALRNPAVTSVNHVIVFQRTGKPGNWQDGRDLWWHEL
VAQADDHCPPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNWPTASRMGQVVDKHQVNILYTAPTA
IRALMADGDKAIEGTSRQSLKIMGSVGEPINPEAWEWYFKKIGNSRCPIVDTWWQTETGG
FMITPLPGAIEPKPGSATLPFFGVQPALVDNIGNPQDGACEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHSLKGQAIYAYITLNHGEEPTSELYTEVRNWVRKEIGPIATPDILHWTD
ALPKTRSGKIMRRILRKIAAGDTSNLGDISTLADPGVVEKLLEEKQAMDNTPS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagccaatataataaacaccctatacctaccgcgattgcggaaaacgccttaatcacc
gccgaacagtataaaaagatgtatcaggcatcggtgcaagatcctgattccttctggcgg
gaacaaggcaagataatcgattggatcaaaccctatcaacaggtcaaaaacacctctttt
gacccaggccatgttcgcattcgctggttcgaagacggcacgctcaatgtcgcggcaaac
tgtctcgatcgtcatcttgctacgcaaggcgatcaaaccgcgatcatttgggaaggcgac
gacgccaaagaaagcaaaaaagtcacctatcgtgaactgcatcaggcggtctgccgtttt
gccaatgtactgaaatcaaaagggatcagtaagggcgatgtggtcgctatttatatgccg
atggtgccggaagcggccgtggcgatgctggcctgtgcccgcatcggtgccgtgcattca
gtgatcttcggcggattttctccggaatcgatcgccgggcgaatcgtcgattccagcgcc
aagctggtgatcaccgccgatgaaggcgttcgcgccgggcggacgatcccactgaaaaag
aatatcgacgaagccctgcgcaacccggccgtcaccagcgtcaaccatgtgatcgttttc
caacgcaccggtaaacccggaaactggcaagacggcagagatctgtggtggcacgagctg
gtcgcacaggcggatgatcattgcccgcctgaagaaatgaatgcagaggatccgctgttt
atcctctatacatccggctcaaccggtaaacctaaaggggtgctgcataccaccggcggt
tatctggtatacgccgcgacgacgtttaaatatgtgtttgattatcaccccggcgacatt
tattggtgtaccgccgacgtcggttgggttaccggccacagctacctgttgtacggcccg
ctggcctgcggcgccatcacgctgatgttcgaaggcgtacctaactggccaaccgccagc
cggatgggacaagtggtggacaaacatcaggtcaatatcctgtacaccgcaccaacggcc
atccgcgcgctgatggcggacggcgacaaagctatcgagggcacctcacgccagtcgctc
aaaatcatgggctcggtgggggaacccatcaacccggaagcctgggaatggtacttcaaa
aaaatcggcaacagccgttgcccgattgtcgatacctggtggcaaacggaaacaggtggc
ttcatgatcactccgttgcccggcgccattgaacctaaacccggttcagcgacgttaccg
ttcttcggggtgcagcccgccttggtagacaacatcggtaacccacaagacggtgcctgc
gaaggcaacctggtgattaccgattcctggcccggtcaggctcgcacgctgtttggtgac
catgaacgttttgaacagacctacttctctacgttcaagggcatgtatttcagcggcgac
ggcgcacgccgtgatgaagacggctattactggatcaccggccgcgtggacgacgtgctg
aacgtatccgggcaccggctgggaacggcggaaatcgaatccgcactggtttcacacccg
aaaatcgccgaagcagcggtagtcggcattccgcacagcctcaaagggcaggcgatctat
gcttacatcacgctgaatcatggcgaagagccgaccagtgaactgtataccgaagtgcgc
aactgggtacgaaaagagataggccctatcgcgacgccggatatcctgcactggaccgac
gctctaccgaaaacccgatccggcaaaatcatgcggcgtattctgcgcaagattgcagcc
ggggataccagcaatctgggggatatctcaaccctcgccgatcctggcgtggtagagaaa
ttgctggaagaaaaacaagccatggacaacacaccgtcttaa

DBGET integrated database retrieval system