KEGG   Dickeya zeae: Dd1591_3405Help
Entry
Dd1591_3405       CDS       T00930                                 

Definition
dolichyl-phosphate beta-D-mannosyltransferase
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
dze  Dickeya zeae
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3875836..3876624
Genome map
AA seq 262 aa AA seqDB search
MDKKYTWEVPEYEETRVKLKQHEYCTLIFVINEGDKLIKQLARMDEARACTDIVIADGGS
TDGSTSTENLEKYGVTSLLVKTGAGKLGSQMRMGFAWALSEGYKGIIVIDGNNKDSVDDI
PNFVLQLENGMDHVQGSRFIPGGKHVNTPKSRLIGLKVIHVPLVRLFSGFKYTDTTNGFR
AYSAKYLVDEKLAVFRNIFTGYELHYYLAIQAAKLGFKCVEIPVMRIYPKHGKTPTKISP
IRGNIQVIVRLLEVCLGKYDKK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaatatacctgggaagtgcctgaatatgaagaaacgagagttaaactcaag
caacatgaatattgcacattaattttcgtcataaatgaaggtgataagttaataaaacag
ttagcacgcatggatgaagccagggcctgtactgatattgtcattgccgatggaggtagc
accgatgggtcaaccagtactgaaaacttagaaaaatatggcgtaacaagcctcttagtc
aaaactggtgcagggaagctgggtagccaaatgcgtatgggcttcgcatgggcgctttcg
gaaggttataaaggtattattgttattgacggaaacaacaaagacagtgttgatgacata
ccaaatttcgttctccaactagaaaatggtatggatcatgttcagggttctcgatttatc
cctggaggaaaacatgtaaatacgcctaaatctcgcctcatcggattaaaggtcatccat
gttccacttgtaagattattttccggtttcaaatatacggatactactaatggttttcgt
gcttatagcgcaaaatatttggtagatgaaaaactggcagtattcagaaatattttcacg
ggttacgaacttcattattatcttgcaatacaagctgccaagttaggatttaaatgtgta
gaaatccctgtaatgcgaatctatcctaagcatgggaaaacaccgacaaaaattagtcct
atcagaggtaatatacaggttatcgtcaggttattagaagtgtgcttagggaaatatgac
aaaaaatag

DBGET integrated database retrieval system