KEGG   Dickeya chrysanthemi: Dd1591_3901Help
Entry
Dd1591_3901       CDS       T00930                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00071  Fatty acid degradation
dze00280  Valine, leucine and isoleucine degradation
dze00281  Geraniol degradation
dze00310  Lysine degradation
dze00362  Benzoate degradation
dze00380  Tryptophan metabolism
dze00410  beta-Alanine metabolism
dze00640  Propanoate metabolism
dze00650  Butanoate metabolism
dze00903  Limonene and pinene degradation
dze00930  Caprolactam degradation
dze01040  Biosynthesis of unsaturated fatty acids
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01120  Microbial metabolism in diverse environments
dze01130  Biosynthesis of antibiotics
dze01200  Carbon metabolism
dze01212  Fatty acid metabolism
Module
dze_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dd1591_3901
   00650 Butanoate metabolism
    Dd1591_3901
  Lipid metabolism
   00071 Fatty acid degradation
    Dd1591_3901
   01040 Biosynthesis of unsaturated fatty acids
    Dd1591_3901
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dd1591_3901
   00310 Lysine degradation
    Dd1591_3901
   00380 Tryptophan metabolism
    Dd1591_3901
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dd1591_3901
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Dd1591_3901
   00281 Geraniol degradation
    Dd1591_3901
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dd1591_3901
   00930 Caprolactam degradation
    Dd1591_3901
Enzymes [BR:dze01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Dd1591_3901
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dd1591_3901
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Dd1591_3901
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Dd1591_3901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored ApbA UDPG_MGDP_dh_N NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ACT08701
JGI: Dd1591_3901
UniProt: C6CNA8
Position
4413631..4415820
Genome map
AA seq 729 aa AA seqDB search
MIYQGDTLYLNWLEDGIAELVFAAPGSVNKLDTRTVASLGEALNHLTHQPSLRALLLRSD
KPAFIAGADITEFLSLFAAPPEALHQWLTEANAIFSRLEDLPVPTLSAINGYALGGGCEC
VLATDFRLATPDARIGLPEVKLGIMPGFGGTVRLPRLLGADGALEIITAGKDLSAGEALK
AGLVDAITDSDKLLSSALHMLRLAAEDKLDWRARRRQKQSPLRLNRIEATMSFATANALV
QQATGRHYPAPMMALKTIEAAAGLQRDAALKLETDNFVALTQTTAAYALVGVFLNEQAVK
SAAKKWAADASPPARVAVLGAGIMGGGIACQSARKGVPVWMKDISEKALTLGMEEAAKLL
NAQLERGKLDAMSMAGVLARIHPTLNNNGLEQADLIIEAVVENPQVKARVLADIEAYVSE
QTLIVSNTSTIPIGHLAAALQRPQNFCGMHFFNPVHRMPLVEVIRGPQTDEKTLARVVAF
ASKIGKTPIVVNDCPGFFVNRVLFPYIAAFNLLMRDGADFRDVDAVMEKQFGWPMGPAYL
LDVVGLDTAHHAQAVMSAGFPQRMAKTYRDAVDVLVEHQRFGQKSGAGFYRYYPDAKGKP
HREQDEQTDILLDAVCEPKRTFRAQEIIHRLMVPMLNEVARCLEEGIVATPAEADMALLY
GLGFPPFHGGACRYLDTLGSQRYVDIARSLASLGPLYAIPESLLQMAQRQQRYYPVVEPH
SNLSLHQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgatctatcaaggcgacacgctgtaccttaactggctggaagacggcattgccgaactg
gtttttgccgcacccggcagcgtcaacaagctggatacccgcaccgtagccagtcttggc
gaagccctgaatcacctgacgcaccagccctcactccgcgcgctgctactgcgctcggat
aaacccgccttcattgccggagcggacatcaccgaattcctgtcgctgtttgccgccccg
ccggaagcgctgcatcagtggctgaccgaagccaacgccattttcagccgactggaggat
ttgccggtgccgacgttatccgccatcaacggctatgcgctgggcggaggatgcgaatgc
gtgctggcgaccgatttccgtcttgcaacgcctgatgcgcgcatcggcctgccggaagtc
aaactgggtatcatgccgggatttggcggcacggttcgattgccgaggctgctgggcgcg
gacggcgcgctggaaatcatcactgcgggtaaagacctgtctgccggcgaggctctgaaa
gccgggctggtggatgcgataacagacagcgacaagctgctgtcttccgccctgcatatg
ttgcgtctggcggcagaggataaactggactggcgtgcccgtcgccgtcagaaacaatcg
ccgctacgacttaaccgtatcgaagccaccatgagttttgctaccgccaacgcgctggtg
caacaggcgacaggccgccactaccccgcaccgatgatggcgctcaaaaccatcgaagcc
gccgccggattacagcgagacgccgcgctaaagctcgaaaccgataatttcgtcgcgctg
actcaaaccaccgcagcatatgcgttggtcggtgtattccttaatgagcaggcggtaaaa
agcgccgccaaaaaatgggctgccgatgcctcaccgccggctcgcgttgccgtactcggc
gccgggatcatgggcggcggcattgcctgccagtcggcacgcaaaggggtgccggtgtgg
atgaaagatatcagtgaaaaagcgctgacactggggatggaggaagcagccaagctgctt
aacgcgcagttggaacgcggcaaattggacgccatgagcatggcgggggtgctggcccgt
attcacccgacactcaataacaacgggcttgaacaggctgacctgattatcgaagccgtc
gtagaaaatccgcaggtaaaagccagggtgctggccgatatcgaagcctatgtcagcgaa
caaacgttgattgtttccaatacgtcgacgattcccatcgggcacttagccgccgccttg
cagcggccgcaaaatttctgcgggatgcactttttcaacccggtacaccggatgccgctg
gtggaagtgattcgcggcccccagaccgacgagaaaacgctggcccgcgtggtggccttc
gccagtaagatcggcaaaaccccgatcgtggtgaacgactgcccgggattcttcgtcaac
cgcgtgctgtttccctacattgccgccttcaacctgctgatgcgcgacggcgcggatttc
cgcgatgtggacgcggtgatggagaaacagttcggttggccgatggggccggcttacctg
ctggacgtcgtcgggctggataccgctcaccacgcgcaggcggtaatgtcggcaggcttt
ccccagcgtatggcgaaaacctatcgcgatgcggtcgatgtgctggtggaacaccagcgt
ttcggtcagaagagcggcgcgggcttctaccgctactatccggatgccaaaggcaaacca
caccgcgagcaggacgaacagaccgatatcttgctggatgcggtctgcgagccgaagcga
accttccgtgcacaagagattatccatcgcctgatggtgccgatgctcaacgaagtggcg
cgttgtctggaagaaggcatcgtcgccaccccggcggaagccgacatggcgctgctttac
ggcctgggtttcccgccattccacggcggcgcctgccgttatctggatacactgggcagc
cagcgctatgtcgacatcgcccggtcgctggcgtcgttggggccgctttacgccataccg
gaaagcctgttgcagatggcgcaacgccaacagcgctattacccggtggttgaacctcac
agcaacctttctcttcatcaaccggcataa

DBGET integrated database retrieval system