KEGG   Dickeya zeae Ech1591: Dd1591_3908Help
Entry
Dd1591_3908       CDS       T00930                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
dze  Dickeya zeae Ech1591
Pathway
dze00860  Porphyrin and chlorophyll metabolism
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01120  Microbial metabolism in diverse environments
Module
dze_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dd1591_3908
Enzymes [BR:dze01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Dd1591_3908
Exosome [BR:dze04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dd1591_3908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACT08708
JGI: Dd1591_3908
UniProt: C6CNB5
Position
complement(4421335..4422357)
Genome map
AA seq 340 aa AA seqDB search
MSNVFPGAFPGRRLRRLRRHDFSRRLVAEHQVTVNDLIYPVFVMEGKQGRQEVPSMPGVY
RLTIDELVREAEVIAKLGIPVLSLFPVIEADKKSLLAEEAYNPDGLVQRTVRALKDAVPE
LGLLTDVALDPYTTHGQDGVIDEEGYVVNDITKEILVRQALSHAQAGAEIVAPSDMMDGR
VGAIRGRLEEQGLVNTQIMAYSAKYASCYYGPFRDALGSSGNLKGGNKKNYQMDPANTNE
ALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPTFAYQVSGEYAMQMAAIQNGWL
QEQPLVMESLLCFKRAGADGVLTYFAKRVAEWLRDEALRR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatgtttttcccggtgcgtttcctggacgtcgcctgcgccgtctgcgccgtcat
gatttcagccgtcgtctggtggcggagcatcaggtcacggtcaacgacctcatctacccg
gtgtttgtcatggaaggcaaacaggggcgtcaggaagtgccctccatgccgggcgtgtat
cgcctgacgattgatgaactggtccgcgaagcggaggttatcgccaaattgggcatcccg
gtgttgtcgctgttcccggtgattgaagcggataaaaagtcgttgctggctgaagaagcc
tacaacccggatgggctggtgcagcgtaccgtgcgcgcgttgaaagatgcggtgccggaa
ctggggctgctgaccgatgtggcgttggacccttacaccactcacggtcaggatggcgta
atcgacgaagagggttacgtggtcaatgacattaccaaagagattctggtgcgtcaggcg
ttgtctcacgcgcaagccggtgcggagatcgtggcacccagcgatatgatggatggccgt
gtcggcgctatccgtgggcggttggaagagcaagggttggtcaatacccagatcatggcg
tattccgccaagtacgcgtcttgctactacgggccgttccgcgatgcgcttggctcgtcg
ggcaacctgaaaggcggcaacaagaaaaattaccagatggatccggccaatacgaatgag
gcattgcaggaaatcgcacaagacctgcaggaaggggctgatatggtgatggtgaaaccg
gggatgccgtatctggatgtggtgcgtcgggtgaaggataccttcggcgtaccgactttc
gcttatcaggtgtccggtgagtacgcgatgcagatggcggcgatccagaatggttggcta
caggagcagccgttggtgatggagtcgctgttgtgtttcaaacgtgccggcgctgatggg
gtgttgacctatttcgccaaacgcgtagccgaatggttgcgtgatgaagcgctgcgccgt
taa

DBGET integrated database retrieval system