KEGG   Dickeya zeae: Dd1591_4019Help
Entry
Dd1591_4019       CDS       T00930                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dze  Dickeya zeae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dd1591_4019
   01230 Biosynthesis of amino acids
    Dd1591_4019
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd1591_4019
   00030 Pentose phosphate pathway
    Dd1591_4019
   00051 Fructose and mannose metabolism
    Dd1591_4019
   00052 Galactose metabolism
    Dd1591_4019
  Energy metabolism
   00680 Methane metabolism
    Dd1591_4019
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dd1591_4019
Enzymes [BR:dze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dd1591_4019
Protein phosphatases and associated proteins [BR:dze01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dd1591_4019
Messenger RNA biogenesis [BR:dze03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dd1591_4019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4538056..4539018)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALAENLDVYGIYDGYLGLYEDRMVQLDRYSVSD
VINRGGTFLGSARFPAFREEAVRQVCVENMKKRDLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEVDFKKEDLVEEIKAGIAKGKKHAIVAITELVCDVDELAHYIEAETE
RETRATVLGHIQRGGSPVAYDRILASRMGAYSIELLQQGYGGRCVGIQNEKLVHHDIIDA
IENMKRPFKGDWLNTAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatcggagtactgacgagcggtggcgatgcgccggggatgaatgcggcc
attcgtggtgtggtgcgtgccgcgttagcggaaaacctggacgtatacggcatttatgac
ggctatctgggtttgtacgaagaccgcatggtgcagttggaccgctacagcgtatcggat
gtgatcaaccgcggcggcactttcctcgggtctgcccgcttcccggcgtttcgcgaagaa
gcggtgcgccaggtgtgcgtggaaaacatgaaaaagcgtgatctggacgcgctggtggtt
atcggcggcgacggttcctacatgggggccaagcgcttgaccgaaatgggtttcccctgc
atcggtttgccgggcaccattgataacgatgtggcgggcaccgattacaccatcggttat
ttcaccgcgttggaaaccgtagtggaagcgattgaccgcctgcgcgatacctcctcttcc
catcagcgtatttccattgtggaagtgatggggcgtcattgcggcgatctgacgctggcc
gcggcgatcgccgggggatgtgagttcatcgtgttgccggaagtcgatttcaaaaaagaa
gacctggtggaagagatcaaagccggtatcgccaaagggaaaaaacacgccattgtggcg
attaccgagctggtgtgcgacgtggatgagctggcgcactatattgaagcggaaaccgaa
cgcgaaacccgcgccaccgtgctggggcacatccagcgcggcggttcgccggtagcgtat
gaccgcattcttgcctcccgcatgggcgcgtattccatcgaactgttgcagcagggctac
ggcggccgttgcgtcgggatccagaatgaaaaactggtccaccatgatattatcgacgcc
atcgagaacatgaagcgtccgttcaaaggcgactggctgaataccgccaagaagctgttc
tga

DBGET integrated database retrieval system